KEGG   Arabidopsis thaliana (thale cress): AT4G08920Help
Entry
AT4G08920         CDS       T00041                                 

Gene name
CRY1
Definition
(RefSeq) cryptochrome-1
  KO
K12118  
cryptochrome 1
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
Circadian rhythm - plant
Brite
KEGG Orthology (KO) [BR:ath00001]
 Organismal Systems
  Environmental adaptation
   04712 Circadian rhythm - plant
    AT4G08920 (CRY1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Structure
PDB: 

Jmol
Position
4
AA seq 681 aa AA seqDB search
MSGSVSGCGSGGCSIVWFRRDLRVEDNPALAAAVRAGPVIALFVWAPEEEGHYHPGRVSR
WWLKNSLAQLDSSLRSLGTCLITKRSTDSVASLLDVVKSTGASQIFFNHLYDPLSLVRDH
RAKDVLTAQGIAVRSFNADLLYEPWEVTDELGRPFSMFAAFWERCLSMPYDPESPLLPPK
KIISGDVSKCVADPLVFEDDSEKGSNALLARAWSPGWSNGDKALTTFINGPLLEYSKNRR
KADSATTSFLSPHLHFGEVSVRKVFHLVRIKQVAWANEGNEAGEESVNLFLKSIGLREYS
RYISFNHPYSHERPLLGHLKFFPWAVDENYFKAWRQGRTGYPLVDAGMRELWATGWLHDR
IRVVVSSFFVKVLQLPWRWGMKYFWDTLLDADLESDALGWQYITGTLPDSREFDRIDNPQ
FEGYKFDPNGEYVRRWLPELSRLPTDWIHHPWNAPESVLQAAGIELGSNYPLPIVGLDEA
KARLHEALSQMWQLEAASRAAIENGSEEGLGDSAEVEEAPIEFPRDITMEETEPTRLNPN
RRYEDQMVPSITSSLIRPEEDEESSLNLRNSVGDSRAEVPRNMVNTNQAQQRRAEPASNQ
VTAMIPEFNIRIVAESTEDSTAESSSSGRRERSGGIVPEWSPGYSEQFPSEENGIGGGST
TSSYLQNHHEILNWRRLSQTG
NT seq 2046 nt NT seq  +upstreamnt  +downstreamnt
atgtctggttctgtatctggttgtggttctggtggttgtagtattgtatggtttagaaga
gatcttagggttgaagataatccagctttagcagcagcagtaagagctggtccagtgatt
gctctgtttgtttgggcaccagaagaagaaggacactatcatccaggtagggtttctagg
tggtggctcaagaacagtttggctcagcttgattcttctcttagaagtcttggtacttgt
cttatcaccaagagatctactgatagtgttgcttctcttcttgatgttgttaaatccact
ggtgcttctcagatcttcttcaaccatttgtatgatccattgtctttggtgcgtgatcac
cgagctaaagatgttttgacggcgcaaggcatagcggttcgatcattcaacgcagacttg
ctttatgagccatgggaagtgactgatgaattaggccgtcctttctctatgtttgctgcg
ttttgggagagatgtcttagtatgccttatgaccctgagtctcctcttcttccacctaag
aagatcatttcaggggatgtgtctaaatgtgttgcggatccattggtgtttgaggatgac
tctgagaaaggaagcaatgcacttctggctcgtgcttggtctcctggatggagtaatggt
gataaagctctcacaacgtttataaacggtccattgcttgaatactctaagaaccgcaga
aaagccgatagtgctacaacctcgtttctttctccacacttgcattttggggaagtgagt
gtgagaaaagtttttcatcttgttcggatcaaacaggtcgcgtgggcaaacgaaggaaac
gaggccggggaagaaagcgtgaatcttttcctgaaatctattggtctcagggagtattct
aggtacataagttttaaccatccatattcccatgaaagaccacttcttggccatctaaag
ttcttcccttgggctgtggatgagaactatttcaaggcatggaggcaaggccggactgga
tatccgttggtcgatgccgggatgagagagttatgggctactggttggttgcatgatcgc
ataagagtagttgtttcaagcttctttgttaaagtgcttcaattaccatggagatggggg
atgaagtatttctgggacacacttcttgatgcggatttagaaagcgatgctcttggttgg
caatacattaccggtactctcccggatagccgggagtttgatcgcatagataaccctcag
tttgaagggtacaagtttgatccaaatggtgaatacgtaaggcgatggcttcctgaactc
tctagactcccgacagactggatacatcatccgtggaacgcacctgagtccgttcttcaa
gctgctggtatcgagcttggatcaaactatcctctaccaattgtaggattagacgaagca
aaagcacggcttcatgaagcgctttcacagatgtggcaactagaagctgcttcaagagct
gcaatagagaacggatccgaagaaggacttggagattctgctgaggtagaggaagctcct
atagagttcccaagggacattacaatggaagagactgaaccaaccagactcaacccaaac
aggagatatgaggatcagatggttccaagcattacttcttctttgatcagacctgaagaa
gacgaagagtcgtctcttaatttgagaaattcagtaggagatagcagagcagaggttcca
aggaacatggttaacaccaaccaagctcagcagcggagagcagaaccggcttcaaaccaa
gtcactgctatgattccagaatttaatatcagaattgttgcagagagcactgaagactca
acagcggaatcttccagcagcggaaggagagaaagaagcggaggcatagtccccgagtgg
tctccagggtactcagagcagttccctagtgaagaaaatggtattggaggaggaagtaca
acgtctagctacttgcagaatcaccatgaaatactgaactggagacggctttcacaaacc
gggtaa

DBGET integrated database retrieval system