KEGG   Arabidopsis thaliana (thale cress): AT4G09760Help
Entry
AT4G09760         CDS       T00041                                 

Definition
choline synthase
Orthology
K14156  
choline/ethanolamine kinase [EC:2.7.1.32 2.7.1.82]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
Glycerophospholipid metabolism
Metabolic pathways
Module
Phosphatidylethanolamine (PE) biosynthesis, ethanolamine => PE
Brite
KEGG Orthology (KO) [BR:ath00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    AT4G09760
Enzymes [BR:ath01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.32  choline kinase
     AT4G09760
    2.7.1.82  ethanolamine kinase
     AT4G09760
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
4
AA seq 346 aa AA seqDB search
MAVGIFGLIPSSSPDELRKILQALSTKWGDVVEDFESLEVKPMKGAMTNEVFMVSWPRKE
TNLRCRKLLVRVYGEGVELFFNRDDEIRTFEYVARHGHGPTLLGRFAGGRVEEFIHARTL
SATDLRDPNISALVASKLRRFHSIHIPGDRIMLIWDRMRTWVGQAKNLCSNEHSTEFGLD
DIEDEINLLEQEVNNEQEIGFCHNDLQYGNIMIDEETNAITIIDYEYASYNPIAYDIANH
FCEMAADYHSNTPHILDYTLYPGEEERRRFICNYLTSSGEEAREEDIEQLLDDIEKYTLA
SHLFWGLWGIISGYVNKIEFDYIEYSRQRFKQYWLRKPKLLSFFPS
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atggcggtaggaatctttggattgatcccaagctcatcaccagacgagctaaggaagatt
cttcaagcgctttcgacgaaatggggagacgtagttgaggattttgagagtcttgaagtg
aagccaatgaaaggagcgatgactaacgaagtgttcatggttagttggcctagaaaagaa
acgaatcttcgatgtaggaagcttcttgttcgtgtttatggtgaaggtgttgagcttttc
ttcaatagagacgatgagattcgtacttttgagtatgttgctcgtcatggtcacggtcct
acacttcttggtcgcttcgccggcggtagagtcgaagagtttatccatgcccggacacta
tcggcaaccgatcttcgtgatccgaacatatcagctcttgttgcatctaagctaagaaga
tttcacagcatacacattcctggagatagaattatgctcatctgggacaggatgaggact
tgggtaggacaagccaagaatctatgttcaaatgaacattcaacagagtttggtctagac
gacattgaagatgaaatcaacctgctggaacaagaagtgaacaatgaacaagagattggc
ttctgtcacaatgacttgcagtatggtaacatcatgattgatgaagaaaccaatgcaatt
actatcattgattatgagtatgcaagttataatccgatcgcttacgacatagcaaatcat
ttctgtgaaatggcggcagattatcattcaaacactcctcatatcttggactacactcta
tatccaggggaagaagaaaggaggagattcatatgtaactacttaacctcttcaggtgaa
gaagcaagagaagaagacatagaacaacttttggatgatattgagaagtatacattggca
agccatctcttctggggtttatggggaatcatatctggttatgtgaacaagattgagttt
gattatatcgagtattcgaggcagagattcaaacagtattggcttcgcaagccaaagctt
ttatctttcttcccatcctaa

DBGET integrated database retrieval system