KEGG   Arabidopsis thaliana (thale cress): AT4G10040Help
Entry
AT4G10040         CDS       T00041                                 

Gene name
CYTC-2
Definition
cytochrome c-2
Orthology
K08738  
cytochrome c
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
Sulfur metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ath00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    AT4G10040 (CYTC-2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
4
AA seq 112 aa AA seqDB search
MASFDEAPPGNPKAGEKIFRTKCAQCHTVEKGAGHKQGPNLNGLFGRQSGTTPGYSYSAA
NKSMAVNWEEKTLYDYLLNPKKYIPGTKMVFPGLKKPQDRADLIAYLKEGTA
NT seq 339 nt NT seq  +upstreamnt  +downstreamnt
atggcgtcgttcgacgaagcacctcccggaaaccccaaagccggtgaaaagatcttcaga
accaagtgcgctcagtgtcacaccgtcgagaaaggtgccggtcacaaacaaggaccgaat
ttgaatggattgtttggaagacaatctggaacaactccaggatattcttactctgctgct
aacaaaagcatggctgtgaattgggaggagaagactctttacgattacttgttgaatcct
aagaagtacatccctggaacaaaaatggtgtttcctggactgaaaaaaccgcaagatcgt
gccgatctcatcgcttatttgaaggaaggtactgcttag

DBGET integrated database retrieval system