KEGG   Arabidopsis thaliana (thale cress): AT4G10060Help
Entry
AT4G10060         CDS       T00041                                 

Definition
beta-glucosidase, GBA2 type family protein
Orthology
K17108  
non-lysosomal glucosylceramidase [EC:3.2.1.45]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ath00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    AT4G10060
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    AT4G10060
Enzymes [BR:ath01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     AT4G10060
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
4
AA seq 922 aa AA seqDB search
MEKNGHTESELQTQMVGNERLPQVTWQRKLNSKVKNPSEFKMSIRDVLHLFPLGYRLWRY
TKEEAKKGRFSMYDIFKKRHVRGDHGVPLGGIGGGSIGRSYKGEFQQFKLFPKICEEAPI
LTNQFSVFVSRPGGLSYSTVLCPTKPKSVKGKTEDLGIESWDWNMEGDKSTYHALYPRSW
TVYNEPDPELRIVSRQVSPFIPHNYKESSLPVSVFEFTMSNLGKEEATVTLLFTWENSVG
GASGLTGEHFNSTIMERDGVHAIVLHHKTGNGHPPVTYAIAAQETEDVHVSECPCFLVSG
HSPKEITAKEMWDEIKKNKSFDELNSEPGSPSRPGTSIGAAIAAKVKVPPGCDRTVTFSL
SWDCPEVRFNEKTYHRRYTKFYGNLGDAAVKMARDALLNYVDWESQIEAWQSPILSDTTL
PDWYRVTLFNELYYFNSGGTIWTDGLPPKESIERSKVTNTEQNDIVIDLFQKINAVCEQI
YSPQSSNSEENIGQFIYLEGIEYLMYNTYDVHFYSSFALLSLFPKLALSIQRDFAATVLI
QDPTKKKIMSSGEWVTRKLLGSVPHDIGLNDPWLELNEYNFFNTDRWKDLNAKFVLQVYR
DVVATNDQSFAKAVWPSVYTAVAYLDQFDKDEDGMIENEGFPDQTYDAWSVTGVSAYCGG
LWVAALQAASAFASIVGENAVAIYFNAKYEKAKIVYEKLWNGSYFNYDDSGSGSSSSILA
DQLAGQWYARACGLKPITKEEWIKKALETIYEFNVMKVKGGTRGAVNGMSTEGKVDTNSL
VSKEVWAGTTYSVAACMIQEGQREKGFQTASGIYEAIWSDRGLSCSFQTPEAWNMNDEYR
SLCYMRPLAIWAIQWALTRTQSFGEEKQKLVAGDEEEESNLLLRQHKGFKDVARFVKIVP
TSNVHRSRLQHTYETVLKTLRL
NT seq 2769 nt NT seq  +upstreamnt  +downstreamnt
atggagaagaatggtcacacggaaagtgaacttcaaactcaaatggttggaaatgagaga
ctacctcaagtaacgtggcaacggaagttgaacagcaaagtgaagaacccttctgagttc
aagatgagtataagagatgttcttcatctgtttcctctaggctatagattgtggcgttac
actaaagaagaggcaaaaaaaggaagattttcgatgtacgatatcttcaaaaagcgccat
gtaagaggcgaccatggtgtcccattaggtggaattggtggaggaagcatcggaaggagt
tacaaaggtgaatttcagcagtttaagctcttccctaaaatttgtgaagaagctccaatc
ctcacaaaccagttctctgtttttgtgtcgagacccggtggcttgagctactccactgtt
ctatgcccaacaaagccaaaatctgtaaaaggtaaaacagaggatttaggaatagaatca
tgggactggaacatggaaggggacaaatctacctatcatgctttgtatccaaggtcttgg
accgtatacaacgagcctgaccctgaactcagaatagtttctcgtcaagtgtcgcctttt
atacctcataactacaaggaaagcagtcttccggtatcggttttcgaatttacgatgagt
aaccttggaaaagaagaagcaacggttactttgctctttacttgggagaactcagtggga
ggagcttctggtttaactggagaacacttcaactcaacaataatggaaagagatggagta
catgcaatagttttacatcacaagacgggcaatggacatccgccagttacttacgctatt
gcagcgcaagaaacagaggatgttcatgtctctgagtgtccatgcttcttagtttctggt
cactctcctaaagaaatcacagcaaaagagatgtgggatgagattaaaaagaacaaatca
ttcgacgagttaaacagcgaaccaggctcaccttcgagacccggaacatccattggagca
gccatagctgctaaagtgaaggttcctccaggttgtgaccgtactgtcacgttttcactc
tcatgggactgtcctgaggtgcggttcaatgaaaagacttaccacagacgatacacaaaa
ttctatggcaacttaggcgatgcagcagtgaaaatggcccgcgacgctcttctaaattac
gttgattgggagtctcagattgaagcatggcaaagccctattctctcagacactacactt
cctgactggtaccgagttactctattcaacgaactatactatttcaactccggaggaact
atctggacagatggcttgcctcccaaggaaagcatagaaagaagcaaggttacaaataca
gaacagaacgacattgttatagacctcttccagaaaatcaatgcggtttgtgagcagatt
tattctcctcaatcctcgaactcggaagagaacattggccaattcatctacctagaagga
attgagtatctaatgtacaacacttacgatgtgcacttctattcttcatttgcacttctc
agtctctttcctaagctcgcactcagtatccaaagagactttgcagcaacagttctgatt
caagatccaaccaagaaaaagatcatgagctccggtgagtgggttacaagaaaacttctt
ggatctgttcctcatgatataggtctaaacgatccgtggctagaactaaacgaatataac
ttcttcaacacggatcgttggaaagacttgaacgccaagtttgttcttcaagtctacaga
gacgtggttgctactaacgatcagagttttgctaaagcggtttggccgtctgtttacaca
gcagttgcttacttagatcagttcgataaggacgaggacgggatgatcgaaaacgaaggg
tttccggatcagacatatgatgcttggagtgttacaggggttagtgcttattgtggcggt
ctttgggtcgctgctctacaagctgcgtctgcatttgctagtattgttggggaaaacgct
gttgccatttacttcaatgcaaagtacgaaaaggcgaagattgtttacgagaagctatgg
aatggttcttacttcaattatgacgatagtggtagtggctcgagctcttcgattcttgct
gatcagttggctggacaatggtatgcacgagcgtgtggattgaagccgataacgaaagaa
gaatggataaagaaagcactagagacgatctatgagttcaatgtgatgaaagttaaagga
gggacacgaggcgcagtgaacggaatgtcaacggaaggaaaagtggatacaaattcgttg
gtttcaaaggaagtttgggctggtactacttactctgttgcagcttgtatgattcaagaa
gggcaaagagaaaaagggtttcagacagcaagtggaatctacgaggctatttggtctgat
cgtggtctcagttgctcgtttcagacaccagaagcgtggaacatgaatgatgaatacaga
tctctgtgttatatgagacctcttgctatatgggctatacaatgggcattgacacgaaca
caatcttttggagaagagaagcaaaagttagtggcaggagatgaagaagaagaaagtaat
ttgttgttaagacaacacaaagggttcaaagatgtggctcgttttgtgaaaatagtacca
acgagcaatgtgcatagaagccgtctccaacacacgtacgagaccgttctcaagactctc
cgcttgtaa

DBGET integrated database retrieval system