KEGG   Arabidopsis thaliana (thale cress): AT4G10330Help
Entry
AT4G10330         CDS       T00041                                 

Definition
(RefSeq) glycine-rich protein
Organism
ath  Arabidopsis thaliana (thale cress)
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
4
AA seq 130 aa AA seqDB search
MSNRRRTGDDDKGLLWKLPQVRIRDIGKVGPAFGLGVGCGFGFGAGLIGGVGFGPGVPGL
QFGLGFGAGCGIGVGFGYGVGRGAAYDHSRSYYNVGKPSLNEVDSLIDELVVSTKKLVKA
TTNEIDKWLK
NT seq 393 nt NT seq  +upstreamnt  +downstreamnt
atgagcaacagaagaagaaccggagacgatgacaaaggattgctctggaaacttccccaa
gttaggatcagagacattggaaaagttggtccagcttttggactcggtgtcggttgcgga
tttggtttcggcgccggtcttatcggaggtgtaggattcggaccaggagttcctggatta
caatttggtcttggatttggagctggttgtggaattggtgtaggttttggctatggtgtt
ggaagaggagctgcttatgatcactctcgttcttattacaacgttggaaaaccatctctg
aatgaagttgattcactgattgatgaacttgttgttagcacgaagaagcttgtgaaagct
actacaaatgaaatcgacaagtggttaaaatga

DBGET integrated database retrieval system