KEGG   Arabidopsis thaliana (thale cress): AT4G10570Help
Entry
AT4G10570         CDS       T00041                                 

Gene name
UBP9
Definition
ubiquitin-specific protease 9
Orthology
K11835  
ubiquitin carboxyl-terminal hydrolase 4/11/15 [EC:3.1.2.15]
Organism
ath  Arabidopsis thaliana (thale cress)
Brite
Enzymes [BR:ath01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     AT4G10570 (UBP9)
Peptidases [BR:ath01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   AT4G10570 (UBP9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
4
AA seq 923 aa AA seqDB search
MTIPNSDFMLENGVCDLPFTPEEEKRIVSELTSESEDNLKQGNLYFVISKRWYTSWQEYV
ENSANECSTGESSEAPRPGPIDNHDIIESDSDINDPQLRRLLVEGEDYVLVPKQVWKRLV
EWYSGGPPIERKLICQGFYTRSYSVEVYPLCLMLTDGRDESRTVIRLGKQASIRELYEKV
CAMTGVPQEKAHIWDYFDKRKNGLLDPLSYKSLEESSLHMDQDILVEVDGLSSSSQSAMS
STGNELALVPLEPSRSIVTIAGGPTLSNGHSTTSNFSLFPRITSEDDGRDSLSILGKGEK
GGLAGLSNLGNTCFMNSALQCLAHTPPIVEYFLQDYSDDINRDNPLGMCGELAIAFGDLL
KKLWSSGRNAVAPRAFKTKLARFAPQFSGYNQHDSQELLAFLLDGLHEDLNKVKRKPYIE
LKDSDSRPDDEVAEELWNYHKARNDSVIVDVCQGQYKSTLVCPVCGKISITFDPFMYLSV
PLPSTLTRSMTITVFYCDGSRLPMPYTVIVPKQGSIRDLITALGTACCLAEDESLLLAEV
YDHKIFRYFEIPLDSLSAIKDDEHIVAYRLNQIPKGSRKAKLEILHGGQERAVLDSVRGS
DVKLFGTPFVTYVNTEPLSGTDIDAVISGFLSPLHKVHAPSKIHNGSDNGHLADATVDQA
SGILSSPDTEIDNASDRELSFRIFLTDERGLNIKPLQSESSISPGTVTRVLVEWNEGEHE
RYDSSYLSDLPEVHKTSFSAKKTRQESISLFSCLEAFLAEEPLGPDDMWFCPSCKEHRQA
NKKLDLWKLPDILVFHLKRFTYSRYLKNKIDTFVNFPVHDLDLSKYVKNKNGQSYLYELY
AVSNHYGGLGGGHYTAYAKLIDDNKWYHFDDSHVSSVNESEIRNSAAYVLFYRRVRSETE
TQTAEMSTDMDYSCLNSHNDKAS
NT seq 2772 nt NT seq  +upstreamnt  +downstreamnt
atgacgatccctaattccgatttcatgttagaaaacggagtctgtgatttgccttttact
cctgaggaagagaaacggattgtatcggagcttactagcgaatcggaggataatttgaaa
caaggcaacttgtattttgtcatctctaaaaggtggtatacaagctggcaggaatatgtt
gagaattcggctaatgaatgttcaactggagagtcttcggaagctccgaggcctggaccg
attgataaccatgatattatcgaaagtgatagcgacattaatgatccacaacttcgtaga
ttgctggtggaaggggaggactacgttttagttcctaaacaagtttggaaaagacttgtt
gaatggtatagcggaggtcctccgatagaaaggaagttgatctgtcaaggcttttataca
aggagttatagtgtagaggtttatccactctgccttatgttgacagacggacgagatgaa
agtagaactgtaatacggttgggaaaacaggcctctataagggaactttatgagaaggtt
tgtgctatgacaggggtaccgcaagaaaaggctcatatctgggattacttcgataagagg
aaaaacggactgttggatcctttatcttacaagagcctggaagagtcaagccttcatatg
gaccaagatattcttgttgaagttgatgggttgtcttcctcctctcaatctgctatgagc
tcgacaggaaatgagttagctctggtacctctggaaccttcaaggtcgattgttacaatt
gctggggggcctaccctatcaaatggtcattccactacgtccaactttagtctctttccg
agaataacttctgaagacgacggcagagattctttgagtattcttggaaaaggagaaaag
ggaggattagcaggattgagtaatttgggaaatacctgctttatgaatagcgctcttcag
tgtttggcccacacacctccaattgttgaatacttcttgcaagattacagtgacgacata
aatagagataatcctttgggaatgtgtggtgagcttgctatcgcgtttggtgatttgttg
aagaaattatggtcatcaggaaggaatgcagttgcaccacgcgcttttaagacgaaattg
gctagatttgccccacagtttagtggttacaatcagcatgattctcaagaactgcttgct
ttcttattagatgggctgcatgaagatttgaataaggtcaaacgaaaaccttacatcgaa
cttaaagattctgacagtcgtccggatgatgaagttgctgaagagctttggaattatcat
aaggcccgaaatgattctgtaatagttgacgtctgtcaaggccaatacaagtcaactctg
gtttgtccagtttgcggaaaaatatcaatcacttttgatcccttcatgtacttgtctgta
cctttgccatcaacacttacgcgatccatgacaattacggtgttttattgcgatggaagt
cgtcttccgatgccatacacagtaatagtgcctaaacagggatctattagagatctcatt
accgcattaggtactgcttgttgtttagctgaagatgagagtcttttacttgcagaggta
tatgatcacaagatctttagatattttgagattcccctggattcactgagtgcgataaaa
gatgatgagcatattgtggcgtatcggttgaatcagattccgaaaggatcaagaaaagca
aaactcgaaattcttcatggagggcaggaaagggctgttctggatagtgttagaggcagc
gacgtgaagctttttggaactccttttgtgacttatgtcaacacagaaccactaagtgga
actgacattgatgcagttatctctggatttttgtcgcctctgcacaaggtccatgcccca
tctaagattcataacggaagtgataatggccaccttgctgatgctactgttgaccaagca
tccggaattttatcatccccagataccgagatagacaatgcatctgatagagagttatcc
ttcaggatattcttgacagatgaacgtggtttgaacattaaaccactgcagtctgaatct
tctataagcccgggtaccgttacaagagttttagtcgagtggaatgagggtgagcatgaa
agatatgattccagctacttgagtgatcttccagaggttcataaaacaagtttctctgca
aagaagacaaggcaagaatcgatatccctgttttcgtgtttggaggcttttttagcagaa
gaacctctgggaccagatgacatgtggttttgtccgagctgcaaagaacacagacaagcg
aacaaaaagctagacctgtggaagttaccagatattcttgtgtttcatttaaaaaggttc
acttacagcagatatctgaagaacaagattgatacgtttgtgaatttcccagttcatgat
ctagacttgagcaagtatgtgaaaaacaagaatggccagtcatatctttatgaactgtat
gccgttagtaatcattacggtggacttggtggtggccactacactgcctacgctaagttg
attgatgacaacaaatggtaccatttcgacgacagtcatgtgtcatctgtaaatgaatct
gaaatcagaaactcagctgcatatgttcttttctaccgaagagtgagaagtgaaacagag
acacaaacagctgagatgtcgactgatatggattattcatgcctaaattctcataatgac
aaagcatcatga

DBGET integrated database retrieval system