KEGG   Arabidopsis thaliana (thale cress): AT4G10570Help
Entry
AT4G10570         CDS       T00041                                 

Gene name
UBP9
Definition
(RefSeq) ubiquitin-specific protease 9
Organism
ath  Arabidopsis thaliana (thale cress)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MIPS: 
TAIR: 
Araport: 
UniProt: 
Position
4
AA seq 923 aa AA seqDB search
MTIPNSDFMLENGVCDLPFTPEEEKRIVSELTSESEDNLKQGNLYFVISKRWYTSWQEYV
ENSANECSTGESSEAPRPGPIDNHDIIESDSDINDPQLRRLLVEGEDYVLVPKQVWKRLV
EWYSGGPPIERKLICQGFYTRSYSVEVYPLCLMLTDGRDESRTVIRLGKQASIRELYEKV
CAMTGVPQEKAHIWDYFDKRKNGLLDPLSYKSLEESSLHMDQDILVEVDGLSSSSQSAMS
STGNELALVPLEPSRSIVTIAGGPTLSNGHSTTSNFSLFPRITSEDDGRDSLSILGKGEK
GGLAGLSNLGNTCFMNSALQCLAHTPPIVEYFLQDYSDDINRDNPLGMCGELAIAFGDLL
KKLWSSGRNAVAPRAFKTKLARFAPQFSGYNQHDSQELLAFLLDGLHEDLNKVKRKPYIE
LKDSDSRPDDEVAEELWNYHKARNDSVIVDVCQGQYKSTLVCPVCGKISITFDPFMYLSV
PLPSTLTRSMTITVFYCDGSRLPMPYTVIVPKQGSIRDLITALGTACCLAEDESLLLAEV
YDHKIFRYFEIPLDSLSAIKDDEHIVAYRLNQIPKGSRKAKLEILHGGQERAVLDSVRGS
DVKLFGTPFVTYVNTEPLSGTDIDAVISGFLSPLHKVHAPSKIHNGSDNGHLADATVDQA
SGILSSPDTEIDNASDRELSFRIFLTDERGLNIKPLQSESSISPGTVTRVLVEWNEGEHE
RYDSSYLSDLPEVHKTSFSAKKTRQESISLFSCLEAFLAEEPLGPDDMWFCPSCKEHRQA
NKKLDLWKLPDILVFHLKRFTYSRYLKNKIDTFVNFPVHDLDLSKYVKNKNGQSYLYELY
AVSNHYGGLGGGHYTAYAKLIDDNKWYHFDDSHVSSVNESEIRNSAAYVLFYRRVRSETE
TQTAEMSTDMDYSCLNSHNDKAS
NT seq 2772 nt NT seq  +upstreamnt  +downstreamnt
atgacgatccctaattccgatttcatgttagaaaacggagtctgtgatttgccttttact
cctgaggaagagaaacggattgtatcggagcttactagcgaatcggaggataatttgaaa
caaggcaacttgtattttgtcatctctaaaaggtggtatacaagctggcaggaatatgtt
gagaattcggctaatgaatgttcaactggagagtcttcggaagctccgaggcctggaccg
attgataaccatgatattatcgaaagtgatagcgacattaatgatccacaacttcgtaga
ttgctggtggaaggggaggactacgttttagttcctaaacaagtttggaaaagacttgtt
gaatggtatagcggaggtcctccgatagaaaggaagttgatctgtcaaggcttttataca
aggagttatagtgtagaggtttatccactctgccttatgttgacagacggacgagatgaa
agtagaactgtaatacggttgggaaaacaggcctctataagggaactttatgagaaggtt
tgtgctatgacaggggtaccgcaagaaaaggctcatatctgggattacttcgataagagg
aaaaacggactgttggatcctttatcttacaagagcctggaagagtcaagccttcatatg
gaccaagatattcttgttgaagttgatgggttgtcttcctcctctcaatctgctatgagc
tcgacaggaaatgagttagctctggtacctctggaaccttcaaggtcgattgttacaatt
gctggggggcctaccctatcaaatggtcattccactacgtccaactttagtctctttccg
agaataacttctgaagacgacggcagagattctttgagtattcttggaaaaggagaaaag
ggaggattagcaggattgagtaatttgggaaatacctgctttatgaatagcgctcttcag
tgtttggcccacacacctccaattgttgaatacttcttgcaagattacagtgacgacata
aatagagataatcctttgggaatgtgtggtgagcttgctatcgcgtttggtgatttgttg
aagaaattatggtcatcaggaaggaatgcagttgcaccacgcgcttttaagacgaaattg
gctagatttgccccacagtttagtggttacaatcagcatgattctcaagaactgcttgct
ttcttattagatgggctgcatgaagatttgaataaggtcaaacgaaaaccttacatcgaa
cttaaagattctgacagtcgtccggatgatgaagttgctgaagagctttggaattatcat
aaggcccgaaatgattctgtaatagttgacgtctgtcaaggccaatacaagtcaactctg
gtttgtccagtttgcggaaaaatatcaatcacttttgatcccttcatgtacttgtctgta
cctttgccatcaacacttacgcgatccatgacaattacggtgttttattgcgatggaagt
cgtcttccgatgccatacacagtaatagtgcctaaacagggatctattagagatctcatt
accgcattaggtactgcttgttgtttagctgaagatgagagtcttttacttgcagaggta
tatgatcacaagatctttagatattttgagattcccctggattcactgagtgcgataaaa
gatgatgagcatattgtggcgtatcggttgaatcagattccgaaaggatcaagaaaagca
aaactcgaaattcttcatggagggcaggaaagggctgttctggatagtgttagaggcagc
gacgtgaagctttttggaactccttttgtgacttatgtcaacacagaaccactaagtgga
actgacattgatgcagttatctctggatttttgtcgcctctgcacaaggtccatgcccca
tctaagattcataacggaagtgataatggccaccttgctgatgctactgttgaccaagca
tccggaattttatcatccccagataccgagatagacaatgcatctgatagagagttatcc
ttcaggatattcttgacagatgaacgtggtttgaacattaaaccactgcagtctgaatct
tctataagcccgggtaccgttacaagagttttagtcgagtggaatgagggtgagcatgaa
agatatgattccagctacttgagtgatcttccagaggttcataaaacaagtttctctgca
aagaagacaaggcaagaatcgatatccctgttttcgtgtttggaggcttttttagcagaa
gaacctctgggaccagatgacatgtggttttgtccgagctgcaaagaacacagacaagcg
aacaaaaagctagacctgtggaagttaccagatattcttgtgtttcatttaaaaaggttc
acttacagcagatatctgaagaacaagattgatacgtttgtgaatttcccagttcatgat
ctagacttgagcaagtatgtgaaaaacaagaatggccagtcatatctttatgaactgtat
gccgttagtaatcattacggtggacttggtggtggccactacactgcctacgctaagttg
attgatgacaacaaatggtaccatttcgacgacagtcatgtgtcatctgtaaatgaatct
gaaatcagaaactcagctgcatatgttcttttctaccgaagagtgagaagtgaaacagag
acacaaacagctgagatgtcgactgatatggattattcatgcctaaattctcataatgac
aaagcatcatga

DBGET integrated database retrieval system