KEGG   Arabidopsis thaliana (thale cress): AT4G10590Help
Entry
AT4G10590         CDS       T00041                                 

Gene name
UBP10
Definition
(RefSeq) ubiquitin-specific protease 10
Organism
ath  Arabidopsis thaliana (thale cress)
SSDB OrthologParalogGFIT
Motif
Pfam: UCH DUSP UCH_1 USP7_C2 DUF5014
Motif
Other DBs
NCBI-GeneID: 826651
NCBI-ProteinID: NP_001328409
MIPS: AT4G10590.1
TAIR: AT4G10590
Araport: AT4G10590
UniProt: Q93Y01 B9DFI6
Position
4
AA seq 910 aa AA seqDB search
MTIPNSDFMIENGVCDFPTTPEEEKRIVSELITESEDNLKEGNLYFVISKRWYTSWEKYV
EQSTKEYISGESSEASRPGPIDNHDIIESESDVNDPQLRRLLMERVDYVLVPQEVWKRLV
EWYSGGPPIERKLICQGFYTRSYSVEVYPLCLMLTDGRDESRTVIRLGKQASIRELYEKV
CALTGVPQEKAHIWDYFDKRKNGLLDSLSYKSLEESSLHMDQDILLEVDGSSSSQSAMSS
TGNELALVPLEPSRSSVTIAGGPTLSNGHSTTSNFSLFPRITSEDDGSNSLSILGKGEKG
GLAGLSNLGNTCFMNSALQCLAHTPPIVEYFLQDYSDDINRDNPLGMCGELAIAFGDLLK
KLWSSGRNSVAPRAFKTKLARFAPQFSGYNQHDSQELLAFLLDGLHEDLNKVKRKPYIEL
KDSDSRPDDEVAEELWNYHKARNDSVIVDVCQGQYKSTLVCPACGKISITFDPFMYLSVP
LPSTLTRSMTVTVFYCDGSHLPMPYTVIVPKNGSIRDLITALGTACLLAEDESLLLAEVY
DHKIFKYFENPLDSLSSIKDDEHIVAYRLNQMPKGSGKAKLEILHGGQKRPILESVRGRD
VKLFGTPFVTYVNTEPLSGADIDAVLSRFLSPLHKVHAPSKIHNGSENGHLPDATVDEAS
EILSSPDTEIDDASDRELSFRIFLTDERGLNFKPLQSESSISLGIATRVLVEWNEGEHER
YDSSYLSDLPEVHKTSFSAKKTRQESISLFSCLEAFLAEEPLGPDDMWFCPSCKEHRQAN
KKLDLWKLPDILVFHLKRFTYSRYLKNKIDTFVNFPVHDLDLSKYVKNKNDQSYLYELYA
VSNHYGGLGGGHYTAYAKLIDDNEWYHFDDSHVSSVNESEIKNSAAYVLFYRRVRSETET
QTVEMSTDMD
NT seq 2733 nt NT seq  +upstreamnt  +downstreamnt
atgacgatccctaattccgatttcatgatcgagaacggagtctgtgattttccgactact
cctgaagaagagaaacggattgtatcggagctgattaccgaatcggaggataatttgaag
gaagggaacttgtattttgtcatctctaaaaggtggtatacaagctgggagaaatatgtt
gagcaatcgacaaaagaatatataagtggagagtcctctgaagcttcaaggccaggaccg
attgataaccatgatattatcgaaagtgaaagcgacgttaatgatccacaacttcgtaga
ttgttgatggaacgggttgactacgttttagttcctcaagaagtttggaaaagacttgtt
gaatggtatagcggaggtcctccgatagaaaggaagttgatctgtcaaggattttatact
aggagttatagtgtagaggtttacccactctgccttatgttgacggacggacgagatgaa
agtagaactgtaatacggttgggaaaacaggcctctataagggaactttatgagaaggtt
tgtgctttgacaggggtaccacaagaaaaggctcatatctgggattacttcgataagagg
aaaaacggactcttggattctttatcttacaagagcctggaagagtcaagccttcatatg
gaccaagatattctacttgaagttgatgggtcgtcttcctctcagtctgctatgagctcg
acaggaaatgagttagctctggtacctctggaaccttccaggtcgagtgttacaattgct
ggggggcctaccctatcaaatggtcattccactacgtccaactttagtctctttccgaga
ataacttctgaagacgacggcagcaattctttgagtattcttggaaaaggagaaaaggga
ggattagcaggattgagtaatttgggaaatacctgctttatgaatagcgctcttcagtgt
ttggcccacacacctccaattgttgaatacttcttgcaagattacagtgacgacataaat
agagataatcctttgggaatgtgtggtgagcttgctatcgcgtttggtgatttgttgaag
aaattatggtcatcaggaaggaactcagttgcaccacgcgcatttaagacaaaattggct
agatttgctccacagtttagtggttacaatcagcatgattctcaagaactgcttgctttc
ttattggatgggctgcatgaagatctgaataaggtcaaacgaaaaccttacatcgaactt
aaagattctgacagtcgtccggatgatgaagttgctgaagagctttggaattatcataag
gcccgaaatgattctgtaatagttgatgtttgtcaaggccaatacaagtccactctggtt
tgtccagcttgcggaaaaatatcaatcacttttgatcccttcatgtacttgtctgtacct
ttgccatcaacacttacgcgatccatgacagttacggtgttttattgcgatggaagtcat
cttccgatgccatacacagtaatagtgcctaaaaatggatctattagagatctcattacc
gcattaggtactgcttgtttattagccgaagatgagagtcttttacttgcagaggtatat
gaccacaagatttttaaatattttgagaatcccctggattcactgagttcgataaaagat
gatgagcatattgtagcctatcggttaaatcagatgccgaaaggatcagggaaagcaaaa
ctcgaaattcttcatggagggcagaaaaggcctattctggagagtgttagaggcagagat
gtgaagctctttggaactccttttgtgacttatgtcaacacagaaccactaagtggagct
gacattgatgcagttctctctcgatttctgtcgcctctgcacaaggtccatgccccatct
aagattcataacggaagtgaaaatggccaccttcctgatgctactgttgacgaagcatcc
gaaattttatcatccccagataccgagatagacgatgcatctgatagagagttatccttc
aggatattcttgacagatgaacgtggtttgaactttaaaccactgcagtctgaatcttcc
ataagcctgggtatcgctacaagagttttagtcgagtggaatgagggtgagcatgaaaga
tatgattccagctacttgagtgatcttccggaggttcataaaacaagtttctctgcaaag
aagacaaggcaagaatcgatatccctgttttcgtgtttggaggcgtttttagcagaagaa
cctctgggaccagatgacatgtggttttgtccgagctgcaaagaacacagacaagcgaac
aaaaagctagacctgtggaagttaccagatattcttgtgtttcatttaaaaaggttcact
tacagcagatatctcaagaataagattgatacgtttgtgaatttcccagttcatgatcta
gacttgagcaagtatgtgaaaaacaagaatgaccagtcatatctatatgaactgtatgcc
gttagtaatcattatggtggacttggtggtggccactacactgcctacgctaagttgatt
gatgacaatgaatggtaccatttcgacgacagtcatgtgtcatctgtaaatgaatctgaa
ataaaaaactcagctgcatatgttcttttctaccgaagagtgagaagtgaaacagagaca
caaacagtggagatgtcgactgatatggattag

DBGET integrated database retrieval system