KEGG   Arabidopsis thaliana (thale cress): AT4G11070Help
Entry
AT4G11070         CDS       T00041                                 

Gene name
WRKY41
Definition
(RefSeq) WRKY family transcription factor
Organism
ath  Arabidopsis thaliana (thale cress)
SSDB OrthologParalogGFIT
Motif
Pfam: WRKY
Motif
Other DBs
NCBI-GeneID: 826708
NCBI-ProteinID: NP_192845
MIPS: AT4G11070.1
TAIR: AT4G11070
Araport: AT4G11070
UniProt: Q8H0Y8
Position
4
AA seq 313 aa AA seqDB search
MEMMNWERRSLLNELIHGLKAAKQLQGSSSPSLSASSSYLTTEIKENLLHNIVSSFKKAI
LMLNGSTTQHNPTIELAPDPLAHPGKVPGSPASITGNPRSEEFFNVRSKEFNLSSKKRKM
LPKWTEQVRISPERGLEGPHDDIFSWRKYGQKDILGAKFPRSYYRCTFRNTQYCWATKQV
QRSDGDPTIFEVTYRGTHTCSQGIPLPEKRETKPKHTVAVNYQNLRASLTVRTGGLGSEA
FSFPVTSPLYTYESINGGGTFYHHVGSSGPSDFTGLISTNTSTGSSPIFDVNFQFDPTAE
INTGFPTFFHNSI
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
atggaaatgatgaattgggagcggaggagtttgctaaacgagctaattcatggactaaaa
gcggccaagcagcttcagggttcgtcttctccatcgttgtcagcttcttcttcatatttg
acgacggagataaaggagaatctcttacataacatagtttcttccttcaaaaaagctatt
ttgatgctcaacggatccaccacacaacacaatccaacgatagagcttgcgcctgatccc
ctagctcatcccggaaaggttccaggatctccagcatcgatcaccggaaatccgagaagc
gaagagtttttcaatgtaagatcgaaagaattcaacttaagttctaaaaagaggaagatg
ttgccaaagtggacagagcaagtgagaattagcccagagagaggcttagaaggacctcat
gacgatatcttcagctggagaaaatatggccagaaagacattttgggcgccaaattccca
aggagttattacagatgcacatttcgtaacacacagtactgttgggctacgaaacaagtc
caaagatcggacggtgatccaacgatcttcgaagtaacatacagaggaacacacacttgt
tcacaggggatcccacttccagagaaacgagaaaccaaaccaaaacacacagtagcagta
aattaccagaatctcagggccagtcttaccgtacgtaccggcggacttggaagcgaagct
ttctcattccccgtcacgtcgccgttatacacttacgagtccatcaacggtggtggaacg
ttttaccaccacgtgggaagttctggtccgtcggatttcactggattgatctcaacaaat
acttccacaggaagttctccaatcttcgacgttaattttcaatttgatccaacggctgag
attaacacaggcttccccacttttttccacaattcgatttaa

DBGET integrated database retrieval system