KEGG   Arabidopsis thaliana (thale cress): AT4G11250Help
Entry
AT4G11250         CDS       T00041                                 

Gene name
AGL52
Definition
(RefSeq) AGAMOUS-like 52
Organism
ath  Arabidopsis thaliana (thale cress)
SSDB OrthologParalogGFIT
Motif
Pfam: SRF-TF SKA2
Motif
Other DBs
NCBI-GeneID: 826727
NCBI-ProteinID: NP_192864
MIPS: AT4G11250.1
TAIR: AT4G11250
Araport: AT4G11250
UniProt: Q9SUT6
Position
4
AA seq 329 aa AA seqDB search
MKQASSSSSCNPTSLTNRLKTIFKKAEELSILCAIDVCVIYYGPDGDLRTWPKDRETVKN
MALRYKEDRKRKKCLNLHEFLEKEKVKDKDKYKGKTNYVKNPNWYPNFDHYSPQQLSQLI
QSLERTLSTLQKRLRIVESQKKQNTNLVHQSLTPSYLNQTQHLDPSKFSLYMYNHGDATL
SQLPLSASQSNQLINYQMQHGFGQNMCLDNITNNNNFQHPGVSNTQDYSPLLSANNYGLN
NHLMQQQDQLHGFDQNLCMMSEIINNNNGLQHPNLSNTVPHEFPYGNTSFSQDMFSSYDG
SSLLQTSSLPPLHNIPNSYCFSDNSRLLC
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atgaagcaagcttcttcttcttcgtcatgtaatccaacaagtttaacaaacagacttaaa
acaatctttaagaaagcagaagagctttcgattctctgtgctattgacgtttgcgtcatc
tattacggaccagacggtgatctgagaacatggcctaaggatagagagacagtgaaaaat
atggctttgaggtataaagaggacagaaaacgcaagaagtgcctcaatcttcatgagttc
ctcgagaaagagaaggtgaaggacaaagacaagtataaggggaagacgaattatgtgaag
aaccctaattggtatccaaactttgatcattactctcctcaacaactctctcaattgatt
cagtccttagaacgaacactttctactctccaaaaaaggcttcgtattgttgagtcgcag
aaaaaacagaacacaaacttggtgcatcagagtttaacaccatcgtatctgaaccagaca
caacacttggatcctagcaagttctcgctgtatatgtacaaccatggagatgctactctc
tcacaactcccactgtctgcttcacaatccaatcaactcatcaattaccagatgcagcat
ggttttggtcagaacatgtgtttggacaacatcaccaacaacaacaactttcaacatcct
ggcgtgtcaaacacacaagactactcaccgttactttcggcgaataactacgggttgaat
aatcacttgatgcagcaacaggatcagcttcatggttttgatcagaacttgtgtatgatg
agtgaaatcatcaataacaacaacggtttacaacatcctaatctctcaaacactgttcca
catgaattcccttatggtaacactagcttctctcaagatatgttttcgagctatgatggg
agcagtttgctacagacatcttctctgccacctctccacaacattcctaacagctattgt
ttttctgacaactcaagacttctctgctaa

DBGET integrated database retrieval system