KEGG   Arabidopsis thaliana (thale cress): AT4G11250Help
Entry
AT4G11250         CDS       T00041                                 

Gene name
AGL52
Definition
(RefSeq) protein agamous-like 52
Organism
ath  Arabidopsis thaliana (thale cress)
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
4
AA seq 329 aa AA seqDB search
MKQASSSSSCNPTSLTNRLKTIFKKAEELSILCAIDVCVIYYGPDGDLRTWPKDRETVKN
MALRYKEDRKRKKCLNLHEFLEKEKVKDKDKYKGKTNYVKNPNWYPNFDHYSPQQLSQLI
QSLERTLSTLQKRLRIVESQKKQNTNLVHQSLTPSYLNQTQHLDPSKFSLYMYNHGDATL
SQLPLSASQSNQLINYQMQHGFGQNMCLDNITNNNNFQHPGVSNTQDYSPLLSANNYGLN
NHLMQQQDQLHGFDQNLCMMSEIINNNNGLQHPNLSNTVPHEFPYGNTSFSQDMFSSYDG
SSLLQTSSLPPLHNIPNSYCFSDNSRLLC
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atgaagcaagcttcttcttcttcgtcatgtaatccaacaagtttaacaaacagacttaaa
acaatctttaagaaagcagaagagctttcgattctctgtgctattgacgtttgcgtcatc
tattacggaccagacggtgatctgagaacatggcctaaggatagagagacagtgaaaaat
atggctttgaggtataaagaggacagaaaacgcaagaagtgcctcaatcttcatgagttc
ctcgagaaagagaaggtgaaggacaaagacaagtataaggggaagacgaattatgtgaag
aaccctaattggtatccaaactttgatcattactctcctcaacaactctctcaattgatt
cagtccttagaacgaacactttctactctccaaaaaaggcttcgtattgttgagtcgcag
aaaaaacagaacacaaacttggtgcatcagagtttaacaccatcgtatctgaaccagaca
caacacttggatcctagcaagttctcgctgtatatgtacaaccatggagatgctactctc
tcacaactcccactgtctgcttcacaatccaatcaactcatcaattaccagatgcagcat
ggttttggtcagaacatgtgtttggacaacatcaccaacaacaacaactttcaacatcct
ggcgtgtcaaacacacaagactactcaccgttactttcggcgaataactacgggttgaat
aatcacttgatgcagcaacaggatcagcttcatggttttgatcagaacttgtgtatgatg
agtgaaatcatcaataacaacaacggtttacaacatcctaatctctcaaacactgttcca
catgaattcccttatggtaacactagcttctctcaagatatgttttcgagctatgatggg
agcagtttgctacagacatcttctctgccacctctccacaacattcctaacagctattgt
ttttctgacaactcaagacttctctgctaa

DBGET integrated database retrieval system