KEGG   Arabidopsis thaliana (thale cress): AT4G11600Help
Entry
AT4G11600         CDS       T00041                                 

Gene name
GPX6
Definition
glutathione peroxidase 6
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Class
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:ath00590]
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:ath00480]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
4
AA seq 232 aa AA seqDB search
MLRSSIRLLYIRRTSPLLRSLSSSSSSSSSKRFDSAKPLFNSHRIISLPISTTGAKLSRS
EHSMAASSEPKSLYDFTVKDAKGNDVDLSIYKGKVLLIVNVASQCGLTNSNYTELAQLYE
KYKGHGFEILAFPCNQFGNQEPGTNEEIVQFACTRFKAEYPIFDKVDVNGDKAAPVYKFL
KSSKGGLFGDGIKWNFAKFLVDKDGNVVDRFAPTTSPLSIEKDVKKLLGVTA
NT seq 699 nt NT seq  +upstreamnt  +downstreamnt
atgcttcgctcctcaattcgacttctctatataagaagaaccagtcctctgcttcgaagt
ttatcatcatcatcatcatcatcatcatcaaaacgattcgattctgcgaaaccacttttc
aattctcatcggattatttctcttccaatttctacaacgggagctaaactatctagatcg
gagcattcaatggctgcttcttccgaacccaaatctctttacgatttcaccgtcaaggat
gctaagggaaacgatgttgatctaagcatctacaaagggaaggttcttttgattgtgaac
gttgcttctcaatgtggcttgactaattcgaattatactgagcttgcgcagctgtatgag
aagtacaaaggccatggtttcgagattcttgcgtttccgtgtaaccagtttgggaatcaa
gagcctggtactaatgaagagattgttcagtttgcttgtactcgtttcaaggctgagtac
ccgattttcgacaaggttgatgttaacggtgacaaagctgccccagtctacaagtttctg
aaatcaagcaaaggcgggctctttggagacggcattaagtggaacttcgcaaagttcttg
gttgacaaagatggaaatgttgtcgatcgtttcgcaccaactacctcacctctcagcatt
gagaaggatgtgaagaagttgttgggagttactgcttaa

DBGET integrated database retrieval system