KEGG   Arabidopsis thaliana (thale cress): AT4G14710Help
Entry
AT4G14710         CDS       T00041                                 

Gene name
ATARD2
Definition
(RefSeq) RmlC-like cupins superfamily protein
  KO
K08967  1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase [EC:1.13.11.53 1.13.11.54]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath00270  Cysteine and methionine metabolism
ath01100  Metabolic pathways
Module
ath_M00034  Methionine salvage pathway
Brite
KEGG Orthology (KO) [BR:ath00001]
 Metabolism
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    AT4G14710 (ATARD2)
Enzymes [BR:ath01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.53  acireductone dioxygenase (Ni2+-requiring)
     AT4G14710 (ATARD2)
    1.13.11.54  acireductone dioxygenase [iron(II)-requiring]
     AT4G14710 (ATARD2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ARD Cupin_2 AraC_binding Cupin_1 DegQ
Motif
Other DBs
NCBI-GeneID: 827122
NCBI-ProteinID: NP_001031640
MIPS: AT4G14710.1
TAIR: AT4G14710
Araport: AT4G14710
UniProt: Q8W108
Position
4
AA seq 199 aa AA seqDB search
MGEVVKDGREEVIQAWYMDDSEEDQRLPHHKDPKEFLSLDKLAELGVLSWRLDADNYETD
EDLKKIRESRGYSYMDFCEVCPEKLPNYEVKVKSFFEEHLHTDEEIRYCVAGSGYFDVRD
RNEAWIRVWVKKGGMIVLPAGIYHRFTVDSDNYIKAMRLFVGEPVWTPYNRPHDHLPARK
EYIDNFVKVNEGGVIDASA
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atgggtgaagtggttaaggatggaagagaagaagtgatccaggcatggtatatggatgat
agcgaagaggatcagagacttcctcaccacaaggatcctaaggagtttctatctttggac
aaacttgcagagctgggagtacttagctggagacttgatgctgataactatgaaaccgat
gaggatttgaaaaagatccgcgaatctcgtggttactcttacatggacttttgtgaggta
tgcccggaaaagcttccaaactatgaagtgaaagtgaagagctttttcgaagaacatttg
cacactgatgaagagatccgttactgcgttgcaggaagcggttactttgatgtgagggat
cgcaatgaagcttggattagagtatgggtaaagaagggaggtatgatagtcttacctgct
ggaatatatcatcgcttcaccgtagactcagacaactatatcaaggcaatgcggcttttc
gtgggtgaaccggtctggacaccatacaatcgcccacacgaccacctccctgcaaggaaa
gagtacatcgataatttcgtgaaggtgaatgaaggtggtgtcatagacgcgtcagcctag

DBGET integrated database retrieval system