KEGG   Arabidopsis thaliana (thale cress): AT4G14716Help
Entry
AT4G14716         CDS       T00041                                 

Gene name
ARD1
Definition
acireductone dioxygenase 1
Orthology
K08967  
1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase [EC:1.13.11.53 1.13.11.54]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
Cysteine and methionine metabolism
Metabolic pathways
Module
Methionine salvage pathway
Class
Metabolism; Amino acid metabolism; Cysteine and methionine metabolism [PATH:ath00270]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
4
AA seq 192 aa AA seqDB search
MGEAVKDGREEVIQAWYMDDSEEDQRLPHHKDPKEFVSLDKLAELGVLSWRLDADNYETD
EDLKKIRESRGYSYMDFCEVCPEKLPNYEVKVKSFFEEHLHTDEEIRYCVAGTGYFDVRD
RNEAWIRVLVKKGGMIVLPAGIYHRFTVDSDNYIKAMRLFVGEPVWTPYNRPHDHLPARK
EYVDNFMINASA
NT seq 579 nt NT seq  +upstreamnt  +downstreamnt
atgggtgaagcggtcaaggatgggagagaagaagtgattcaagcttggtatatggatgat
agtgaagaggatcagagacttcctcaccacaaggatcctaaagagtttgtatcgttggac
aaacttgcagagctgggagtacttagctggagacttgatgctgataactatgaaaccgat
gaggatttgaaaaagatccgtgaatctcgtggttactcttacatggacttttgtgaggta
tgcccggaaaagcttccaaactatgaagtgaaagtgaagagctttttcgaagaacattta
cacactgatgaggagatccgttactgcgttgcaggaactggttactttgatgtgagagat
cgtaatgaagcttggattagggtattggtaaagaagggaggtatgatagtcttacctgct
gggatctatcatcgcttcactgtggactctgacaactatatcaaggcaatgcggctattc
gtgggtgaaccggtatggacaccatacaatcgcccacacgaccatcttcctgcaaggaaa
gaatatgtcgataacttcatgatcaatgcctcggcttag

DBGET integrated database retrieval system