KEGG   Arabidopsis thaliana (thale cress): AT4G14716Help
Entry
AT4G14716         CDS       T00041                                 

Gene name
ARD1
Definition
acireductone dioxygenase 1
Orthology
K08967  
1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase [EC:1.13.11.53 1.13.11.54]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
Cysteine and methionine metabolism
Metabolic pathways
Module
Methionine salvage pathway
Brite
KEGG Orthology (KO) [BR:ath00001]
 Metabolism
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    AT4G14716 (ARD1)
Enzymes [BR:ath01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.53  acireductone dioxygenase (Ni2+-requiring)
     AT4G14716 (ARD1)
    1.13.11.54  acireductone dioxygenase [iron(II)-requiring]
     AT4G14716 (ARD1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
4
AA seq 192 aa AA seqDB search
MGEAVKDGREEVIQAWYMDDSEEDQRLPHHKDPKEFVSLDKLAELGVLSWRLDADNYETD
EDLKKIRESRGYSYMDFCEVCPEKLPNYEVKVKSFFEEHLHTDEEIRYCVAGTGYFDVRD
RNEAWIRVLVKKGGMIVLPAGIYHRFTVDSDNYIKAMRLFVGEPVWTPYNRPHDHLPARK
EYVDNFMINASA
NT seq 579 nt NT seq  +upstreamnt  +downstreamnt
atgggtgaagcggtcaaggatgggagagaagaagtgattcaagcttggtatatggatgat
agtgaagaggatcagagacttcctcaccacaaggatcctaaagagtttgtatcgttggac
aaacttgcagagctgggagtacttagctggagacttgatgctgataactatgaaaccgat
gaggatttgaaaaagatccgtgaatctcgtggttactcttacatggacttttgtgaggta
tgcccggaaaagcttccaaactatgaagtgaaagtgaagagctttttcgaagaacattta
cacactgatgaggagatccgttactgcgttgcaggaactggttactttgatgtgagagat
cgtaatgaagcttggattagggtattggtaaagaagggaggtatgatagtcttacctgct
gggatctatcatcgcttcactgtggactctgacaactatatcaaggcaatgcggctattc
gtgggtgaaccggtatggacaccatacaatcgcccacacgaccatcttcctgcaaggaaa
gaatatgtcgataacttcatgatcaatgcctcggcttag

DBGET integrated database retrieval system