KEGG   Arabidopsis thaliana (thale cress): AT4G16144Help
Entry
AT4G16144         CDS       T00041                                 

Gene name
AMSH3
Definition
AMSH-like ubiquitin thiolesterase 3
Orthology
K11866  
STAM-binding protein [EC:3.1.2.15]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
Endocytosis
Brite
KEGG Orthology (KO) [BR:ath00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    AT4G16144 (AMSH3)
Enzymes [BR:ath01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     AT4G16144 (AMSH3)
Peptidases [BR:ath01002]
 Metallo Peptidases
  Family M67
   AT4G16144 (AMSH3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
4
AA seq 507 aa AA seqDB search
MKIDLNKVAREIEVDNRIPLRNYYRIADNLLRQASIYREEKNVVDLYIMLLRYSSLISET
IPFHRDYQASLPQERLGSRKRLRAVINELESLKPEFNQLVDKLNRVEDESRQDGSDLPVV
SYSSDAVEWPPAHKASYSRPDINKPLPTSQPSWTYNNNLTSSSNRTQIDQQFQKLSFDFL
PPNQATLSRHSFLGPNGLKRQMVAPKSEIKVQYPSNTDWGSADNSGLIEAGPSSSSASLN
GDSQEVSTLNSVLSLDDGRWQRHSEAVNSQFISDATEDPFQFVGMKQPSPPPVLAQVHQE
LAQICPSKVADPRPGPAIPSLEGKEGSNSYQHLHVPVRIMDDFLRLARSNTERNLETCGV
LAGSLKNRVFHITTLIIPKQESTSDSCQTLNEEEIFEVQDRLSLFPLGWIHTHPTQTCFM
SSVDLHTHYSYQIMLPEAVAIVMAPTDESTPHGIFHLSDPSGVSVIRNCQQRGFHPHEES
EDGNPIYEHCSHVFLNAKLKYEVLDLR
NT seq 1522 nt NT seq  +upstreamnt  +downstreamnt
atgaagattgatctgaacaaggtggctcgtgaaatcgaagtggataatcgtattcctctc
cgtaattactaccgcatcgccgataatctcctccgacaggccagtatatatcgcgaagag
aagaatgtggtggatttgtatatcatgcttcttagatattcaagtttgatttctgaaaca
attcctttccatcgagattaccaggcatcgcttccacaagaaagacttgggagtaggaag
aggttgcgtgctgtaatcaatgagctcgagtctctgaaaccggaattcaaccagctagtg
gataagctgaacagagttgaggatgaatcccgtcaggatggaagtgatctcccggtcgta
tcatatagttcagatgctgttgagtggcctcctgctcacaaagcttcatactccagacct
gatattaacaagcccttaccgacatctcaaccatcctggacgtataacaataatctgact
tcatcatcaaatcgtacacagattgatcagcagttccagaagctatcttttgatttcctg
cctccaaaccaagcaaccttgtcaagacattcatttctaggtccgaatggtcttaaaagg
caaatggttgcacccaagtcagagataaaggttcaatatccgagtaatacagattggggt
tctgcggacaattcaggtttaattgaagctggacctagcagttcctcagcatcacttaat
ggtgattctcaagaagtctcaacactgaactctgtgctctccttagatgatggtcgatgg
cagcgtcattctgaggcagtaaattcccagtttattagcgacgcaactgaagacccgttt
cagtttgtcggtatgaagcaaccttcccctcctcccgtgcttgctcaagtgcatcaagag
ttagcccaaatttgcccatctaaagtagctgatcctagaccaggacctgcaattccttcc
ctagaaggaaaagagggcagcaattcttatcagcatttgcatgtgcctgtgcgcataatg
gatgatttcctaaggctagctcggtcaaacacagaacggaatttagaaacttgtggagta
cttgctggttctctgaaaaacagggtttttcatatcactactctcataatcccaaagcag
gagtctacctcagattcttgccaaacactaaacgagaagaaatattcgagtacaggacag
actctctctatttcccttgggttggattcatacacaccctacacaaacttgcttcatgtc
atcagttgatctacacacacactactcgtatcagataatgctaccggaggcggtggcaat
cgtaatggcaccaacagacgaatcaacacctcatggaatattccatctctctgatccatc
aggcgtatctgtgatccgaaactgccagcaacgaggcttccacccacacgaagaatcaga
agacggtaacccaatctacgagcattgctcacacgtcttcctcaatgccaaactcaaata
tgaagtcctcgatctccgctaa

DBGET integrated database retrieval system