KEGG   Arabidopsis thaliana (thale cress): AT4G16450Help
Entry
AT4G16450         CDS       T00041                                 

Definition
(RefSeq) NADH-ubiquinone oxidoreductase
Organism
ath  Arabidopsis thaliana (thale cress)
SSDB OrthologParalogGFIT
Motif
Pfam: NADH-u_ox-rdase Voltage_CLC DUF3316
Motif
Other DBs
NCBI-GeneID: 827343
NCBI-ProteinID: NP_001190742
MIPS: AT4G16450.1
TAIR: AT4G16450
Araport: AT4G16450
UniProt: Q84W12
Position
4
AA seq 106 aa AA seqDB search
MNTDITALEKAQYPVVDRNPAFTKVVGNFSTLDYLRFSTITGISVTVGYLSGIKPGIKGP
SMVTGGLIGLMGGFMYAYQNSAGRLMGFFPNDGEVASYQKRGGFSK
NT seq 321 nt NT seq  +upstreamnt  +downstreamnt
atgaatactgacatcactgccttggagaaggcacaatacccagtggttgatcggaatcct
gcttttactaaagtcgtcggcaatttcagcactctcgattacctccgtttctctactatc
accggcatctccgtcaccgtcggctatctctctgggattaagcctgggattaagggaccg
tcgatggttactggaggattgatcgggctcatgggaggtttcatgtatgcgtaccagaac
tctgccggtagactcatggggtttttccctaatgatggtgaagttgctagttaccagaag
cgtggtggtttctccaaatga

DBGET integrated database retrieval system