KEGG   Arabidopsis thaliana (thale cress): AT4G16450Help
Entry
AT4G16450         CDS       T00041                                 

Definition
(RefSeq) hypothetical protein
Organism
ath  Arabidopsis thaliana (thale cress)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
4
AA seq 106 aa AA seqDB search
MNTDITALEKAQYPVVDRNPAFTKVVGNFSTLDYLRFSTITGISVTVGYLSGIKPGIKGP
SMVTGGLIGLMGGFMYAYQNSAGRLMGFFPNDGEVASYQKRGGFSK
NT seq 321 nt NT seq  +upstreamnt  +downstreamnt
atgaatactgacatcactgccttggagaaggcacaatacccagtggttgatcggaatcct
gcttttactaaagtcgtcggcaatttcagcactctcgattacctccgtttctctactatc
accggcatctccgtcaccgtcggctatctctctgggattaagcctgggattaagggaccg
tcgatggttactggaggattgatcgggctcatgggaggtttcatgtatgcgtaccagaac
tctgccggtagactcatggggtttttccctaatgatggtgaagttgctagttaccagaag
cgtggtggtttctccaaatga

DBGET integrated database retrieval system