KEGG   Arabidopsis thaliana (thale cress): AT4G16480Help
Entry
AT4G16480         CDS       T00041                                 

Gene name
INT4
Definition
(RefSeq) inositol transporter 4
  KO
K08150  
MFS transporter, SP family, solute carrier family 2 (myo-inositol transporter), member 13
Organism
ath  Arabidopsis thaliana (thale cress)
Brite
Transporters [BR:ath02000]
 Solute Carrier Family (SLC)
  SLC2: Facilitative GLUT transporter
   AT4G16480 (INT4)
 Major Facilitator Superfamily (MFS)
  Sugar transporters
   Sugar porter (SP) family [TC:2.A.1.1]
    AT4G16480 (INT4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
4
AA seq 582 aa AA seqDB search
MVEGGIAKADKTEFTECWRTTWKTPYIMRLALSAGIGGLLFGYDTGVISGALLFIKEDFD
EVDKKTWLQSTIVSMAVAGAIVGAAVGGWINDKFGRRMSILIADVLFLIGAIVMAFAPAP
WVIIVGRIFVGFGVGMASMTSPLYISEASPARIRGALVSTNGLLITGGQFFSYLINLAFV
HTPGTWRWMLGVAGVPAIVQFVLMLSLPESPRWLYRKDRIAESRAILERIYPADEVEAEM
EALKLSVEAEKADEAIIGDSFSAKLKGAFGNPVVRRGLAAGITVQVAQQFVGINTVMYYS
PSIVQFAGYASNKTAMALSLITSGLNALGSIVSMMFVDRYGRRKLMIISMFGIIACLIIL
ATVFSQAAIHAPKIDAFESRTFAPNATCSAYAPLAAENAPPSRWNCMKCLRSECGFCASG
VQPYAPGACVVLSDDMKATCSSRGRTFFKDGCPSKFGFLAIVFLGLYIVVYAPGMGTVPW
IVNSEIYPLRYRGLGGGIAAVSNWVSNLIVSESFLSLTHALGSSGTFLLFAGFSTIGLFF
IWLLVPETKGLQFEEVEKLLEVGFKPSLLRRREKKGKEVDAA
NT seq 1749 nt NT seq  +upstreamnt  +downstreamnt
atggtggaaggaggaattgcgaaagcagacaaaacagagttcacagagtgttggagaaca
acatggaagacaccttacatcatgcgacttgctctctccgccggaatcggaggtcttctc
ttcggttacgataccggagtcatttccggagctcttcttttcatcaaagaagattttgat
gaagttgataagaaaacatggcttcagtcaactattgttagtatggcagtggctggagcc
atcgtcggagcagcagtcggaggttggatcaatgataagtttggtaggaggatgtcgatt
cttatcgccgatgttcttttcttgatcggtgcgattgtgatggcatttgctccggctcct
tgggttatcatcgttggaagaatctttgttgggtttggtgttggtatggcttcgatgacg
tctccgttgtatatctctgaagcttctccggcgaggattagaggtgcacttgttagtacc
aatggtcttctcatcactggtggacaattcttctcgtacctcatcaatcttgcttttgtc
catactccgggaacatggagatggatgttgggtgttgcgggagttccagctattgttcag
tttgtgcttatgttgtcgctacctgagtctccaaggtggttatatagaaaggacaggatt
gcggaatccagagcgattcttgagaggatttacccggctgacgaagtggaggcggagatg
gaagctttgaaactgtcagtggaggcagagaaagcagacgaggcaatcattggagatagc
ttctctgcaaagctgaaaggagctttcgggaatcccgttgttcgacgtggactcgctgct
ggtatcacggtgcaagtggctcagcagtttgtggggatcaacactgtcatgtactacagt
ccttctattgtgcaatttgctggttacgcctctaacaagacagctatggccttgtctctt
attacttccggtttgaatgctttgggttctattgtgagcatgatgtttgtcgatcggtac
gggagaaggaagctcatgatcatctctatgtttgggatcatagcatgtcttatcatctta
gccacggtgttctcacaagcggccatccacgcccccaagatcgatgcgtttgagtcaagg
acgtttgcaccaaatgctacttgttcagcatatgcccctctcgcagccgaaaatgctcct
ccctcgaggtggaactgcatgaagtgtctcaggtccgaatgtggattctgcgccagcggg
gtacagccgtacgcaccaggagcatgtgtggtgttgtcagatgacatgaaagcaacttgc
agctcaagaggaagaacattcttcaaagatggatgtccaagcaagtttgggttcttagct
atagtgtttttggggctttacatcgtagtctacgcaccaggtatgggcactgtcccgtgg
atcgtcaactctgagatctatccgctcagatacagaggtcttggtggaggaatagccgcc
gtctcgaattgggtctccaacctgatagtgagtgagagcttcctctcactcacccatgct
ctcggctcctctggtaccttccttctctttgctggcttctccacgatcgggctcttcttc
atttggttgctcgttcctgagaccaaagggcttcagtttgaggaggtcgagaagttgctc
gaggtcggcttcaagcccagtctcttgcggcggagggagaagaagggcaaagaagtcgat
gctgcttaa

DBGET integrated database retrieval system