KEGG   Arabidopsis thaliana (thale cress): AT4G16690Help
Entry
AT4G16690         CDS       T00041                                 

Gene name
MES16
Definition
(RefSeq) methyl esterase 16
  KO
K13544  
pheophorbidase [EC:3.1.1.82]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
Porphyrin and chlorophyll metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ath00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    AT4G16690 (MES16)
Enzymes [BR:ath01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.82  pheophorbidase
     AT4G16690 (MES16)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Structure
PDB: 

Jmol
Position
4
AA seq 262 aa AA seqDB search
MGGEGGAEPVIHFVFVHGASHGAWCWYKLTTLLDAAGFKSTSVDLTGAGISLIDSNIVFD
SDQYNRPLFSLLSDLPPHHKVILVGHSIGGGSVTEALCKFTDKISMAIYLAASMVQPGSI
PSPHLSNIHVGEEDIWEYTYGEGTDKPPTGVLMKPEFIRHYYYSQSPLEDVTLSSKLLRP
APMRAFQDLDKLPPNPEAEKVPRVYIKTAKDNLFDSVRQDLLVENWPPSQLYVLEDSDHS
AFFSVPTTLFAYLLRAVSFLQR
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atgggaggagaaggtggtgctgagcccgtaattcactttgtgtttgttcatggagccagt
cacggagcttggtgttggtataaactcaccactcttctcgacgccgccgggttcaaatca
acctccgtagatctcaccggcgctggcatcagcctcatagactctaacatcgtcttcgac
tccgaccaatataaccgtcctctcttctctctcttgtccgatctccctcctcaccacaaa
gtcatactcgttggacatagcatcggtggaggaagtgtcaccgaagctctttgcaagttc
actgacaaaatctccatggccatttacctcgcggcttccatggttcaacccggatccatc
ccttctccgcatctttcaaacatacatgtgggagaagaagatatatgggagtacacatat
ggtgaaggtaccgataaaccacccaccggagtcctcatgaaaccggagtttatacgccat
tattactatagccaaagccctcttgaggacgtaactttgtcatctaagctgttgcgtcct
gctcctatgagggcctttcaagatcttgataagctacctccaaatcccgaggccgagaaa
gttcctcgagtttacatcaagactgctaaggataatctatttgattctgtgcgtcaagac
cttttggtggagaattggccaccttctcagctgtatgtcttggaggatagtgaccattct
gctttcttctctgtcccaactaccttattcgcgtatctcctccgtgcggtttcttttctt
caacgataa

DBGET integrated database retrieval system