KEGG   Arabidopsis thaliana (thale cress): AT4G16970Help
Entry
AT4G16970         CDS       T00041                                 

Definition
(RefSeq) protein kinase superfamily protein
  KO
K02214  
cell division control protein 7 [EC:2.7.11.1]
Organism
ath  Arabidopsis thaliana (thale cress)
Brite
Enzymes [BR:ath01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     AT4G16970
Protein kinases [BR:ath01001]
 Serine/threonine protein kinases: Other group
  CDC7 family
   AT4G16970
DNA replication proteins [BR:ath03032]
 Eukaryotic Type
  DNA Replication Initiation Factors
   DDK (Dbf-4 dependent kinase)
    AT4G16970
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
4
AA seq 889 aa AA seqDB search
MSENSEPRQLENSTAGRELIPLSPTNSDGNDDLNYHLHAFELSRLLLSSGHPESVIDLSS
KCTYFQGSPNLVKYLCSIPNSPISLAEDGFTVTLSPESPSAPASFACSLDLQENVVLEQF
MDPRSLTLKHSRENAEQEELELMPLPKRSRNDGNDVNYSVIDSRPNDIRTVACGTMLGTI
LALESQASVFNLSASNRGIEAFVQDHQPGPQTSNASVDVNPTHRLEESKNDLPSPQEDGY
YERPEIGDFQIADNQILIEEGDDKNKKDLFPKGEIQTDSVQSDPVASLMPTENELEPVQI
VDDTEDLLVDDHTVDIVSTPDRELPLKPSATEANQDKSLVQKTLDQCKLPGNSKTYSCSP
EIKHTRKSKVIQKRKQNFNTVRLKDQKDQAKHNTIPDFDSYTIVEEEGSGGYGIVYKATR
KTDGTEFAIKCPHVGAQKYYVNNEIRMLERFGGKNCIIKHEGCLKNGDSDCIILEHLEHD
RPDSLKREIDVYQLQWYGYCMFKALSSLHKQGVVHRDVKPGNFLFSRKTNKGYLIDFNLA
MDLHQKYRRADKSKAASGLPTASKKHHTLVKSLDAVNRGTNKPSQKTLAPNSIKKAAGKT
RARNDMTRWERLNSQGAEGSGLTSAKDVTSTRNNPSGEKRREPLPCHGRKALLDFLQETM
SVPIPNHEVSSKAPTSMRKRVAALPGKAEKELLYLTPMPLCSNGRPEAGDVIEKKDGPCS
GTKGFRAPEVCFRSLHQGPKIDVWSAGVTLLYLIMGRTPFTGDPEQNIKDIAQLRGSEEL
WEVAKLHNRESSFPKELYESRYLKGMELRKWCELNTKRREFLDVIPLSLLDLVDKCLTVN
PRRRISAEDALKHDFFHPVHETLRNQMLLKQQPTVVADAVSQTLNYLQL
NT seq 2670 nt NT seq  +upstreamnt  +downstreamnt
atgtcagaaaactcggaaccgcgtcaactcgagaattctacagccggaagagagctcatt
cctcttagtcccaccaattcagacggcaacgacgaccttaactatcatctgcatgctttt
gagttatctcgtctcctactttcttctggtcatccagaatctgttatagatctttcttca
aagtgtacatacttccaaggttctcctaatctcgtcaaatatctttgctcgatccctaat
tctcctatttcccttgccgaagatggcttcactgtgactctctcgcctgagtctccctcc
gctccggctagtttcgcctgtagtttggatttgcaggaaaatgttgtgttagaacagttt
atggatccgagatctctcacgctaaagcattcgagagagaatgcggaacaagaggagcta
gagctcatgccattgcccaaaagaagtcgaaatgatggaaacgatgtgaattactctgta
atagatagcagacctaacgacatcagaactgttgcctgtggaactatgcttgggactatt
ttagctcttgaatcccaagcttcggttttcaatttaagtgcatctaaccgaggaatagag
gcttttgttcaagatcatcagcctggtccgcagacatccaatgcttcagtggatgtcaat
cctacacatcggttagaggaaagcaagaacgatttgccatctcctcaggaggatggatat
tacgagcgacctgaaattggagatttccaaattgctgacaaccaaatattaatcgaagaa
ggtgatgataaaaataagaaggatctcttccctaagggagagatacaaactgattctgtg
cagtccgatcccgttgcctcattgatgccaacagaaaatgagttagaaccagtgcagatt
gtggatgacactgaagatctacttgtagatgatcacactgtagacatcgttagcacccct
gacagagagctgccgttgaagccttctgctacagaagctaatcaagataaatctttggta
caaaaaactctggatcaatgcaaattgccgggaaacagcaaaacgtacagctgttcccct
gagataaaacacaccagaaaaagtaaagttatccagaagaggaagcagaattttaacacc
gttcgtcttaaagatcagaaggatcaggcaaagcataacacaattccagattttgattct
tacactattgtagaggaagaaggttcaggtggctacgggattgtttataaggcaacgagg
aaaactgatggaacagagtttgcaattaaatgccctcatgttggcgctcagaagtattat
gtgaataatgaaatcagaatgctggagcgttttggggggaaaaactgtataataaagcat
gaaggctgtctcaagaatggagattctgattgcatcatccttgagcaccttgaacatgac
agacctgattcattgaagagagaaatagatgtgtatcagctgcagtggtacggctactgc
atgttcaaagctctatcgagtctgcataagcagggtgttgttcatagggatgttaagcca
ggaaacttcctcttctctaggaagaccaacaaaggctatctcattgattttaaccttgcc
atggatttgcaccagaagtacagaagagcagataaatcaaaagcagcttcaggtcttcct
accgccagcaagaaacatcatacattggttaaatcactcgatgcggtaaaccgagggacc
aacaaaccttctcagaaaactttagcgcctaatagtatcaagaaagcagcgggaaagaca
agagctcggaatgacatgaccagatgggagagactcaatagccaaggggcagaagggtct
ggcttaacttcagctaaagatgtgaccagcacaaggaacaacccttcaggtgaaaagaga
agagagcctttgccatgtcatggaagaaaagcgcttttagattttctgcaagagacaatg
tctgttccaattccaaaccatgaagtatcatccaaagctcctacgtctatgagaaaacgg
gtagctgctcttccagggaaagctgagaaggaacttctttatctgaccccaatgccactg
tgctctaacggtcggcctgaagcaggggacgtaattgagaagaaagacggtccttgctca
ggaaccaaaggcttccgagctccagaggtttgcttcagatctttgcaccaaggacctaag
atagacgtgtggtctgcgggagttactttgttatacctcataatgggaaggacacctttc
actggtgaccctgaacagaacataaaggacattgcacaactacgaggcagtgaagaatta
tgggaagtagccaagctgcacaaccgtgaatcctctttccctaaggaattatacgagtca
aggtacttgaaggggatggagttgagaaaatggtgcgaactcaacacaaaacgcagagag
tttctagacgtaattccactatcgcttcttgacctcgttgataaatgtttgaccgttaac
ccgaggcgacgaatcagcgcagaggatgctctcaagcacgacttcttccatccagtacat
gaaacccttagaaaccaaatgctccttaaacagcagcctacagtggttgctgacgcagta
agccaaactctaaactatttacaattgtaa

DBGET integrated database retrieval system