KEGG   Arabidopsis thaliana (thale cress): AT4G17020Help
Entry
AT4G17020         CDS       T00041                                 

Definition
transcription factor-related protein
Orthology
K03144  
transcription initiation factor TFIIH subunit 4
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
Basal transcription factors
Nucleotide excision repair
Module
Holo-TFIIH complex
Class
Genetic Information Processing; Transcription; Basal transcription factors [PATH:ath03022]
Genetic Information Processing; Replication and repair; Nucleotide excision repair [PATH:ath03420]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
4
AA seq 482 aa AA seqDB search
MPQVKIIAKNFMDMVASLPAIKLDKLYNNVFICEAILRSLPPLAKKYVLQMLYIDVPVPA
TMMEEWVLADGTSKHRVAIDRLIQLRIFSEISDRKRGTSYSLNPTFQNNLQKHIISGGVL
PREPMNSDNAIKLPSLQELETYALKQWECFLLQLINSGQGEKLTGISSSMMKIFQRGLLS
QRDKDGPRLTESGFQFLLMDTNAQLWYIIREYILNAEERDVDPADLISFLLELSFHVTGQ
AYNLNTLTEVQNNTLKDLADLGLVKLQQGRKDSWFIPTKLATNLSVSLADSSARKEGFVV
METNFRMYAYSTSKLQCEILRLFARIEYQLPNLIACAITKESLYNAFDNGITSDQIITFL
QQNSHPRCADRVPSIPENVTDQIRLWETDLQRIEMTQAHFYDEFPSKDVFEAACDFAREW
RGLLWEDSKRMRLVVKSEVHNQMREFLHTQSSRKRKKSSHLMSCYSISYHRFYPANTCAP
QT
NT seq 1449 nt NT seq  +upstreamnt  +downstreamnt
atgccgcaagttaagatcattgctaaaaatttcatggacatggtggcgtcacttccagcc
atcaagcttgacaaactctacaacaatgtctttatctgcgaagccattctcaggtctttg
ccgcctcttgccaagaagtatgtattgcagatgttgtacattgatgttcctgtacctgct
acgatgatggaggagtgggtgctcgcagatggcacctctaaacatagagttgctattgat
cgactgattcaattaaggattttttcagaaattagtgataggaaaaggggaaccagctac
agcctaaatcctacatttcagaacaatcttcagaaacatattatttccggtggagttttg
cctagagagcctatgaactccgacaatgccattaaacttccaagcctacaagaactcgaa
acctatgcacttaagcaatgggagtgtttcttgctacaacttataaattcgggtcaaggt
gaaaaactaactggcatcagttcatccatgatgaaaatttttcagcgaggtttattgagt
cagagagacaaagatggcccgagattaactgagagtggctttcagtttttgctgatggat
acaaatgcccagctttggtacattattcgagaatacatattgaatgccgaggagcgagat
gtagatccagcagacttgatttcgtttttgttggagcttagttttcatgttactggtcag
gcatataacttaaataccttgacagaggttcaaaacaataccctcaaggaccttgcagac
ttgggattagtcaagcttcaacagggaaggaaagacagttggtttattcctactaaactg
gctacaaatttatcagtcagtctggcagattcatcagcgcgaaaagagggatttgtcgtg
atggaaacaaacttcagaatgtatgcgtactccacatctaagttacagtgtgaaatttta
cgactatttgcgaggatagagtaccaacttccaaaccttattgcttgtgccattacaaag
gaaagtttgtacaatgcatttgacaatggcatcacatcagatcagattataactttcctc
cagcagaattctcatccacgatgtgctgatcgagtcccatctattccagaaaatgtcact
gatcagattcggctttgggagacagatctgcagagaattgagatgacccaggctcacttc
tatgatgaatttccttcaaaagatgtgtttgaggcagcttgtgactttgctcgggaatgg
agaggccttctttgggaagactctaagagaatgcgacttgttgtgaaatccgaagttcac
aatcagatgcgtgagtttcttcatacccaaagcagcagaaagagaaaaaagagtagccat
ttgatgtcttgttactctattagttaccatcgtttttatcctgctaacacatgcgcaccc
caaacgtag

DBGET integrated database retrieval system