KEGG   Arabidopsis thaliana (thale cress): AT4G17090Help
Entry
AT4G17090         CDS       T00041                                 

Gene name
CT-BMY
Definition
beta-amylase
Orthology
K01177  
beta-amylase [EC:3.2.1.2]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:ath00500]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
4
AA seq 548 aa AA seqDB search
MELTLNSSSSLIKRKDAKSSRNQESSSNNMTFAKMKPPTYQFQAKNSVKEMKFTHEKTFT
PEGETLEKWEKLHVLSYPHSKNDASVPVFVMLPLDTVTMSGHLNKPRAMNASLMALKGAG
VEGVMVDAWWGLVEKDGPMNYNWEGYAELIQMVQKHGLKLQVVMSFHQCGGNVGDSCSIP
LPPWVLEEISKNPDLVYTDKSGRRNPEYISLGCDSVPVLRGRTPIQVYSDFMRSFRERFE
GYIGGVIAEIQVGMGPCGELRYPSYPESNGTWRFPGIGEFQCYDKYMKSSLQAYAESIGK
TNWGTSGPHDAGEYKNLPEDTEFFRRDGTWNSEYGKFFMEWYSGKLLEHGDQLLSSAKGI
FQGSGAKLSGKVAGIHWHYNTRSHAAELTAGYYNTRNHDGYLPIAKMFNKHGVVLNFTCM
EMKDGEQPEHANCSPEGLVKQVQNATRQAGTELAGENALERYDSSAFGQVVATNRSDSGN
GLTAFTYLRMNKRLFEGQNWQQLVEFVKNMKEGGHGRRLSKEDTTGSDLYVGFVKGKIAE
NVEEAALV
NT seq 1647 nt NT seq  +upstreamnt  +downstreamnt
atggaattgacactgaattcctcgagttctcttatcaaacgtaaagatgccaagagttct
agaaaccaagaaagttcctccaacaacatgacctttgcgaagatgaagccgccaacatat
caattccaagcaaagaactcggttaaggaaatgaagttcactcacgagaagaccttcacg
ccagaaggtgaaacccttgagaaatgggagaagctccacgttctctcatacccacactcc
aagaacgacgctagcgttccggtgttcgtcatgttaccgctcgacacagtaacaatgtca
gggcatttgaacaaaccacgagccatgaacgctagtttgatggccctgaaaggagctggt
gtggaaggtgtgatggtggatgcttggtggggattggtggagaaagatggacctatgaat
tataactgggaaggctatgccgagcttatacagatggttcaaaagcacggtctcaaactc
caggtcgttatgtcattccatcaatgtggaggaaacgtaggagactcttgcagtatcccc
ttgcctccatgggtgcttgaagagatcagcaagaaccctgatcttgtctacacagacaaa
tctgggagaaggaaccctgaatatatctccttgggatgtgattctgtgcctgtcctaaga
ggaagaacacctatccaggtctactcagatttcatgaggagcttccgtgaacgatttgaa
ggctacataggaggagttattgcggaaattcaagtaggaatgggaccttgtggagaattg
agatacccatcataccctgagagcaacgggacctggagattccccggaattggagagttc
cagtgctacgacaagtatatgaaatcgtcacttcaagcatatgctgagtcaatcgggaaa
actaactggggaacaagtggacctcatgatgccggcgagtacaagaacctcccagaagat
actgaatttttcaggagagacggaacatggaatagcgagtatggaaagtttttcatggaa
tggtactccgggaagctgctagaacatggagaccaactcctatcttcagcgaaaggtatc
tttcaaggaagcggagcaaagctatcaggaaaggtagctggaattcactggcactacaac
accaggtcacacgcagctgagctaaccgctggatactacaacacaagaaaccatgacggg
tatctgccaatagctaagatgttcaacaaacatggagttgtgctcaacttcacctgcatg
gagatgaaagacggggagcaacctgagcacgcgaattgctcaccagaaggtctggtcaag
caagtacagaacgcgacaaggcaggccggaaccgaactagcaggggagaacgcgctagaa
cgatatgactcaagcgcattcggacaagtggtagcaacaaataggtcagattctggaaat
gggttaaccgcatttacttacctaagaatgaacaagcggttatttgagggtcaaaattgg
cagcagttagtggagtttgttaagaacatgaaggaaggtggtcatgggaggagactctca
aaagaagacacaactggaagtgacctttatgttggatttgtcaaaggcaagatcgctgag
aatgtggaggaggctgctttagtgtaa

DBGET integrated database retrieval system