KEGG   Arabidopsis thaliana (thale cress): AT4G17280Help
Entry
AT4G17280         CDS       T00041                                 

Definition
(RefSeq) Auxin-responsive family protein
Organism
ath  Arabidopsis thaliana (thale cress)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
4
AA seq 402 aa AA seqDB search
MSNHMSIMKFLNQILCLSLILSISMTTLSFAQTCSKYKFSSNNVFDSCNDLPFLDSFLHY
TYESSTGSLHIAYRHTKLTSGKWVAWAVNPTSTGMVGAQAIVAYPQSDGTVRVYTSPIRS
YQTSLLEGDLSFNVSGLSATYQNNEIVVLASLKLAQDLGNGGTINTVWQDGSMSGNSLLP
HPTSGNNVRSVSTLNLVSGVSAAAGGAGGSSKLRKRNIHGILNGVSWGIMMPLGAIIARY
LRVAKSADPAWFYIHVFCQASAYIIGVAGWATGLKLGGDSPGIQYSTHRAIGIALFSLAT
VQVFAMFLRPKPEHKHRLYWNIYHHTIGYTIIILGVVNVFKGLGILSPKKQWKNAYIGII
VVLAIVATLLEAFTWYVVIKRRKLEAKTAQHGASNGTRSQYA
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atgagtaatcatatgtccattatgaagttcttgaatcaaatcctctgtctctctcttatc
ctctccatatccatgactactctttcctttgctcagacatgttctaaatacaagttctcc
agcaacaatgtctttgactcttgcaacgatcttccttttcttgattccttcctccattac
acttacgagtcttccaccgggagcctccacattgcttatcgccacactaagctcacctct
ggtaaatgggttgcttgggctgtgaacccaacgtctacgggaatggtgggagctcaagcc
atcgttgcttatccacaatcagatggtactgtcagggtttacacttctcccatcagaagc
taccagacgagtctactagagggtgatctgagtttcaatgtctctggtttgtctgcaact
taccagaacaatgagatcgttgtgttggcaagtctgaagcttgcacaggatcttgggaat
ggtggaaccattaacacagtgtggcaagatgggtcaatgtctgggaacagtcttctgcct
catccaacttctggcaacaatgttcgatcagtgtcaactctcaatctggtatccggtgtt
tcagcagctgcaggaggagctggaggaagttccaagcttcgcaaacgcaatattcatgga
atattgaatggagtgagctggggaatcatgatgccactaggggcaatcattgctcgatac
ttgagagtagccaaatcagcagaccctgcttggttctacattcacgttttctgccaggct
tctgcttacatcatcggtgttgccggatgggccactggtctcaaactcggtggcgactca
ccagggattcagtacagcacccaccgtgccatcgggatcgctctcttctctctagcgaca
gttcaggtgtttgcgatgtttctgaggccaaaaccagagcacaagcataggctctactgg
aacatttaccaccacacgatcggctacacgataatcatcctaggggtggtgaacgttttc
aaagggctaggcatattgagtcccaagaagcagtggaaaaatgcctacatcggtatcatt
gttgttctcgccattgtggccaccctactcgaagccttcacctggtatgtagtcattaaa
agaaggaaactggaggctaaaacggctcagcatggagcatctaacggcactcggtctcag
tatgcttaa

DBGET integrated database retrieval system