KEGG   Arabidopsis thaliana (thale cress): AT4G17470Help
Entry
AT4G17470         CDS       T00041                                 

Definition
putative palmitoyl-protein thioesterase
Orthology
K01074  
palmitoyl-protein thioesterase [EC:3.1.2.22]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
Fatty acid elongation
Metabolic pathways
Fatty acid metabolism
Class
Metabolism; Overview; Fatty acid metabolism [PATH:ath01212]
Metabolism; Lipid metabolism; Fatty acid elongation [PATH:ath00062]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
4
AA seq 308 aa AA seqDB search
MEKSFQRSALLVTLSLFFFSIPVSLSVPFVLFHGFGGECSNDKVSNLTQFLINHSGYPGT
CVEIGDGVKDSLFMPLRQQASIACEKIKQMPELSEGYNIVAESQGNLVARGLIEFCDNAP
PVINYVSLGGPHAGVAAIPEGCDSAFCILMKAFFAVIYSDFAQDHTAPSGYVKKPMEIKN
YLEHSKYLPKLNNERPGEKNSTFKDRFTSLQNLVLIMFQNDTILVPRETSWFGYYPDGAS
SSTPVLPPQKTKLYTEDWIGLKTLDDAGKVRFISVPGGHIEITEEDLVKYVVPYLQNESL
FSSEHETI
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atggagaagagtttccaaaggtctgctctccttgtgactttgtctctcttcttcttctcc
attccggtttcactctctgttccattcgttctgtttcacgggtttggaggtgaatgctcc
aatgacaaagtgagcaacttaacacagttcctcatcaaccactccggctaccctggaact
tgcgtagaaataggagatggagtgaaagattccttattcatgccgcttaggcaacaagcc
agcatagcttgtgagaaaattaaacagatgccagagctgagtgaaggttacaacatagtg
gcagagtctcaaggaaacttggtcgctagaggcctaatcgagttttgcgataatgctcca
ccagtcatcaactatgtctccttaggaggacctcatgctggcgtcgctgcaatccccgag
gggtgtgattcagcattttgcatactcatgaaggcgttttttgcagtgatttacagcgat
tttgctcaagatcatactgctccaagtggttatgtcaaaaaacctatggaaataaaaaat
tatttggaacactccaagtatctgccaaagctaaacaacgagagacctggcgagaaaaac
tccacttttaaagaccgtttcaccagcttgcaaaacttggttctcatcatgttccagaat
gatacaatattggttccaagagaaacttcttggttcggatattacccggatggagcttca
tcttcaacacctgttttgcctcctcaaaagacaaagctatacactgaggattggattggt
ctgaaaaccttggatgatgctggaaaagtgaggtttattagtgtccctggcggacacatc
gaaataacggaagaagaccttgtcaaatacgttgtgccttacctccagaatgagtctttg
ttctcttctgaacacgagacaatatag

DBGET integrated database retrieval system