KEGG   Arabidopsis thaliana (thale cress): AT4G17480Help
Entry
AT4G17480         CDS       T00041                                 

Definition
(RefSeq) alpha/beta-Hydrolases superfamily protein
  KO
K01074  palmitoyl-protein thioesterase [EC:3.1.2.22]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath00062  Fatty acid elongation
ath01100  Metabolic pathways
ath01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:ath00001]
 Metabolism
  Lipid metabolism
   00062 Fatty acid elongation
    AT4G17480
Enzymes [BR:ath01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.22  palmitoyl[protein] hydrolase
     AT4G17480
Lipid biosynthesis proteins [BR:ath01004]
 Fatty acid synthase
  Component type
   AT4G17480
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Palm_thioest DUF676 Lipase_2
Motif
Other DBs
NCBI-GeneID: 827459
NCBI-ProteinID: NP_001328704
MIPS: AT4G17480.1
TAIR: AT4G17480
Araport: AT4G17480
UniProt: A0A1P8B5G7
Position
4
AA seq 249 aa AA seqDB search
MSHLCREIGNGEQDSVTMPLTQQASVACEKVKQMKDLSQGYNIVAQSQGNLVARGLIEFC
DNAPPVFNYISLGGPHAGISDIPKCNSTLCELLKTAVYTDFVQDHIAPSGYIKIPTDIKD
YLEHSKYLPKINNERPNERNTTFKDRFTSLHNLVLVMFEGDAVVIPKESSWFGYYPDGAS
TPLLSPQQTKLYTEDWIGLKTLDAARKVKFVSVPGEHLRIAQDDVVKHVVPYLKNQPASM
SEDLEILHL
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atgtctcatctttgtagagaaataggaaatggagagcaagattcggtgactatgccgctt
acgcaacaagcgagtgtagcgtgtgagaaagttaaacagatgaaggatttgagtcaaggc
tacaacattgttgcacagtctcaaggaaacttggtagctagaggtctaatcgagttttgt
gacaatgctcctccggtcttcaactatatatctttaggaggtcctcatgctggcatatcc
gacattcccaagtgtaattctacactttgcgagttgctgaaaacagcggtctacaccgac
ttcgtacaagatcatattgctccaagtggttatatcaagattcctacagatataaaagat
tacctggaacactccaagtatctgccaaagatcaacaacgagagacctaacgaaaggaac
accacttttaaagaccggttcactagcttgcacaacttggtccttgtcatgtttgagggt
gatgcagtagtgattcctaaagaaagttcttggttcggatattacccggatggagcttcc
acacctcttttgtctcctcaacagacaaagctctatactgaggattggattggtctgaaa
acattggatgctgccagaaaagttaagtttgtcagtgtccctggcgagcacctaagaata
gcgcaagacgacgttgtaaaacacgtcgtgccttacctcaagaaccagcctgcgtctatg
agtgaagatttggagatactgcatctatga

DBGET integrated database retrieval system