KEGG   Arabidopsis thaliana (thale cress): AT4G17510Help
Entry
AT4G17510         CDS       T00041                                 

Gene name
UCH3
Definition
ubiquitin C-terminal hydrolase 3
Orthology
K05609  
ubiquitin carboxyl-terminal hydrolase L3 [EC:3.4.19.12]
Organism
ath  Arabidopsis thaliana (thale cress)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
4
AA seq 234 aa AA seqDB search
MATASESSSSKRWLPLESNPDVMNQYLWGLGLAPDEAECNDVYGLDDELLEMVPKPVLAV
LFLYPITKKSEEERIEQDKEIKEKVHSDKVYFMKQTVGNACGTIGLLHAIGNITSEIKLS
DGSFLDRFFKSTANMTPMERAKFLENDSQIEDAHSVAVIAGDTPASEDADTHFICLACVE
GELYELDGRKAGPISHGASSPATLLKDATKVIKKMIEKNPGSLNFNLIAISKRT
NT seq 705 nt NT seq  +upstreamnt  +downstreamnt
atggcgaccgcaagcgagagttcttcatctaagagatggcttccacttgaatctaaccca
gatgttatgaatcagtatctctggggacttggtcttgcccctgatgaagcagagtgcaat
gatgtgtatgggttagacgatgaacttctagagatggttccaaagcctgttcttgctgtt
ctcttcctttacccaatcaccaaaaagagtgaagaagagagaatcgagcaagacaaggaa
attaaggaaaaggtgcatagcgataaagtttactttatgaaacaaactgttggtaatgct
tgtggaaccattggtcttcttcatgctattgggaatattacctctgaaatcaaactctcc
gacggatcgttcttggatagattcttcaaatccactgccaacatgactcctatggagcgt
gccaagtttctcgagaatgacagtcaaatagaagatgctcattctgtagctgttatagct
ggtgatacacctgcttcagaagacgcagacacgcatttcatttgtttagcttgtgtagaa
ggtgagctctatgaacttgatggaagaaaggcaggaccgatttcacacggtgcttcctct
ccagctaccctcctgaaggacgcaacaaaagtgataaagaagatgatcgagaagaatccg
ggctctctcaacttcaacctgatagccatctctaagagaacctga

DBGET integrated database retrieval system