KEGG   Arabidopsis thaliana (thale cress): AT4G17730Help
Entry
AT4G17730         CDS       T00041                                 

Gene name
SYP23
Definition
(RefSeq) syntaxin of plants 23
Organism
ath  Arabidopsis thaliana (thale cress)
SSDB OrthologParalogGFIT
Motif
Pfam: Syntaxin_2 Syntaxin SNARE DUF4988 MCPsignal V-SNARE
Motif
Other DBs
NCBI-GeneID: 827494
NCBI-ProteinID: NP_567537
MIPS: AT4G17730.1
TAIR: AT4G17730
Araport: AT4G17730
UniProt: O04378
Position
4
AA seq 255 aa AA seqDB search
MSFQDLEAGRGRSLASSRNINGGGSRQDTTQDVASGIFQINTSVSTFHRLVNTLGTPKDT
PELREKLHKTRLYIGQLVKDTSAKLKEASETDHQRGVNQKKKIVDAKLAKDFQAVLKEFQ
KAQRLAAERETVYAPLVHKPSLPSSYTSSEIDVNGDKHPEQRALLVESKRQELVLLDNEI
AFNEAVIEEREQGIQEIQQQIGEVHEIFKDLAVLVHDQGNMIDDIGTHIDNSYAATAQGK
SHLVRHQRHKDQILL
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgagttttcaagatttagaggcgggaagaggaagatcattagcttcttcaaggaacatc
aatggtggtggtagtagacaagacacgactcaagatgttgcttctggtatatttcagatc
aatacaagtgtttccactttccatcgtcttgtcaatactcttggtactcctaaagatacg
cctgagctcagagagaagctgcataagacaagattatatattggacagttagtgaaagat
acatcagctaaacttaaagaagctagtgaaactgatcatcaaagaggtgtaaatcaaaag
aagaagattgtggatgctaagcttgcaaaggactttcaagctgtgttgaaagagtttcaa
aaggctcagcgtcttgctgctgaaagagaaaccgtatatgctcctcttgtccacaagcca
tctcttccctcaagctacacatccagtgagatagatgtgaatggagataagcatccagag
cagcgtgcccttcttgtggaatcaaaaagacaagaacttgtactgttggacaatgagatt
gcgttcaatgaggctgttattgaggaaagagagcaagggatacaagaaattcagcagcaa
attggcgaggtgcacgagatcttcaaagacttggcagtgttggtgcacgatcaaggaaac
atgatagatgatattggtactcacatcgataactcttacgctgcaactgcccaaggaaaa
tcccatctcgtaaggcatcaaagacacaaagatcaaattcttctctga

DBGET integrated database retrieval system