KEGG   Arabidopsis thaliana (thale cress): AT4G17730Help
Entry
AT4G17730         CDS       T00041                                 

Gene name
SYP23
Definition
(RefSeq) syntaxin-23
  KO
K08488  
syntaxin 7
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
SNARE interactions in vesicular transport
Phagosome
Brite
KEGG Orthology (KO) [BR:ath00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04130 SNARE interactions in vesicular transport
    AT4G17730 (SYP23)
 Cellular Processes
  Transport and catabolism
   04145 Phagosome
    AT4G17730 (SYP23)
Membrane trafficking [BR:ath04131]
 SNARE
  Syntaxin (Qa)
   Stx-Endo
    AT4G17730 (SYP23)
Exosome [BR:ath04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   AT4G17730 (SYP23)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
4
AA seq 255 aa AA seqDB search
MSFQDLEAGRGRSLASSRNINGGGSRQDTTQDVASGIFQINTSVSTFHRLVNTLGTPKDT
PELREKLHKTRLYIGQLVKDTSAKLKEASETDHQRGVNQKKKIVDAKLAKDFQAVLKEFQ
KAQRLAAERETVYAPLVHKPSLPSSYTSSEIDVNGDKHPEQRALLVESKRQELVLLDNEI
AFNEAVIEEREQGIQEIQQQIGEVHEIFKDLAVLVHDQGNMIDDIGTHIDNSYAATAQGK
SHLVRHQRHKDQILL
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgagttttcaagatttagaggcgggaagaggaagatcattagcttcttcaaggaacatc
aatggtggtggtagtagacaagacacgactcaagatgttgcttctggtatatttcagatc
aatacaagtgtttccactttccatcgtcttgtcaatactcttggtactcctaaagatacg
cctgagctcagagagaagctgcataagacaagattatatattggacagttagtgaaagat
acatcagctaaacttaaagaagctagtgaaactgatcatcaaagaggtgtaaatcaaaag
aagaagattgtggatgctaagcttgcaaaggactttcaagctgtgttgaaagagtttcaa
aaggctcagcgtcttgctgctgaaagagaaaccgtatatgctcctcttgtccacaagcca
tctcttccctcaagctacacatccagtgagatagatgtgaatggagataagcatccagag
cagcgtgcccttcttgtggaatcaaaaagacaagaacttgtactgttggacaatgagatt
gcgttcaatgaggctgttattgaggaaagagagcaagggatacaagaaattcagcagcaa
attggcgaggtgcacgagatcttcaaagacttggcagtgttggtgcacgatcaaggaaac
atgatagatgatattggtactcacatcgataactcttacgctgcaactgcccaaggaaaa
tcccatctcgtaaggcatcaaagacacaaagatcaaattcttctctga

DBGET integrated database retrieval system