KEGG   Arabidopsis thaliana (thale cress): AT4G17750Help
Entry
AT4G17750         CDS       T00041                                 

Gene name
HSF1
Definition
(RefSeq) heat stress transcription factor A-1a
  KO
K09419  
heat shock transcription factor, other eukaryote
Organism
ath  Arabidopsis thaliana (thale cress)
Brite
Transcription factors [BR:ath03000]
 Eukaryotic Type
  Helix-turn-helix
   Heat shock factors
    AT4G17750 (HSF1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
4
AA seq 495 aa AA seqDB search
MFVNFKYFSFFIRTKMDGVTGGGTNIGEAVTAPPPRNPHPATLLNANSLPPPFLSKTYDM
VEDPATDAIVSWSPTNNSFIVWDPPEFSRDLLPKYFKHNNFSSFVRQLNTYGFRKVDPDR
WEFANEGFLRGQKHLLKKISRRKSVQGHGSSSSNPQSQQLSQGQGSMAALSSCVEVGKFG
LEEEVEQLKRDKNVLMQELVKLRQQQQTTDNKLQVLVKHLQVMEQRQQQIMSFLAKAVQN
PTFLSQFIQKQTDSNMHVTEANKKRRLREDSTAATESNSHSHSLEASDGQIVKYQPLRND
SMMWNMMKTDDKYPFLDGFSSPNQVSGVTLQEVLPITSGQSQAYASVPSGQPLSYLPSTS
TSLPDTIMPETSQIPQLTRESINDFPTENFMDTEKNVPEAFISPSPFLDGGSVPIQLEGI
PEDPEIDELMSNFEFLEEYMPESPVFGDATTLENNNNNNNNNNNNNNNNNNNNTNGRHMD
KLIEELGLLTSETEH
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
atgtttgtaaatttcaaatacttctctttctttatccgtacgaaaatggacggtgttacc
ggcggaggaacgaatatcggcgaggctgtgacggcgccaccaccgcggaatccgcatcca
gcgactttacttaatgcgaactctttaccgccccctttccttagcaagacgtatgacatg
gtggaagatccggcgacggacgcgattgtctcatggagtccgacgaacaatagcttcatt
gtttgggatccaccggagttttctcgtgatcttctacctaaatacttcaaacacaacaat
ttctccagctttgttcgccagttaaacacctatggttttaggaaagtggatccagatcga
tgggaatttgctaatgaaggtttcttaagaggtcaaaaacatctattgaagaagataagc
cggagaaaatctgttcagggacatggtagtagtagtagtaatccacaatctcagcaatta
tctcagggtcaaggttcaatggctgcattatcttcatgtgttgaggttgggaaatttggg
ttagaggaagaagttgaacagcttaaaagagacaaaaacgtgttgatgcaggaactcgtt
aagttacgccagcagcaacaaacaacagataataaacttcaggttttggttaaacatctt
caggttatggagcagaggcaacaacagattatgtctttccttgctaaagctgtacagaat
cctactttcctctctcagtttatacagaagcagactgatagtaatatgcatgtaaccgag
gccaataagaagcggagactcagagaggatagtactgctgctactgagagtaatagtcat
agccatagcttggaagcatcagatggacagatagttaagtatcagccacttagaaacgat
tcaatgatgtggaacatgatgaaaacagatgataagtatccgtttcttgacgggttctca
tctccaaaccaggtatcaggagtcactcttcaagaggtactacccataacttcaggacag
tcacaggcatatgcatctgtaccatcaggacagcctttatcatacttaccctctacttca
acttctctcccggataccataatgccagagacttcccagataccacaattgacacgagag
agtatcaacgacttccctacagaaaacttcatggatacagagaagaatgttccagaggca
ttcatctctccaagcccattccttgatggtggttcagtcccgattcagcttgagggaata
cccgaagaccccgagattgatgaactaatgagtaactttgaattccttgaagaatatatg
ccagaaagcccagtttttggagatgcaactacactagagaacaacaacaacaacaacaac
aacaacaacaacaacaacaacaacaacaacaacaacaacacaaatggtagacatatggat
aagcttatagaagaattgggtcttctcacatcagaaacagaacactag

DBGET integrated database retrieval system