KEGG   Arabidopsis thaliana (thale cress): AT4G18040Help
Entry
AT4G18040         CDS       T00041                                 

Gene name
EIF4E
Definition
translation initiation factor eIF-4E
Orthology
K03259  
translation initiation factor 4E
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
RNA transport
Module
eIF4F complex
Class
Genetic Information Processing; Translation; RNA transport [PATH:ath03013]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
4
AA seq 235 aa AA seqDB search
MAVEDTPKSVVTEEAKPNSIENPIDRYHEEGDDAEEGEIAGGEGDGNVDESSKSGVPESH
PLEHSWTFWFDNPAVKSKQTSWGSSLRPVFTFSTVEEFWSLYNNMKHPSKLAHGADFYCF
KHIIEPKWEDPICANGGKWTMTFPKEKSDKSWLYTLLALIGEQFDHGDEICGAVVNIRGK
QERISIWTKNASNEAAQVSIGKQWKEFLDYNNSIGFIIHEDAKKLDRNAKNAYTA
NT seq 708 nt NT seq  +upstreamnt  +downstreamnt
atggcggtagaagacactcccaaatctgttgtaacggaagaagctaagcctaattcaata
gagaatccgattgatcgataccatgaggaaggtgatgatgccgaagaaggagagatcgcc
ggaggagaaggagacggaaacgttgacgaatcgagcaaatccggtgttcctgaatcgcat
cctctggaacattcatggactttctggttcgataatcctgctgtgaaatcgaaacaaacc
tcttggggaagttccttgcgacccgtgtttacgttttcaactgttgaggaattttggagt
ttgtacaacaacatgaagcatccgagcaagttagctcacggagctgacttctactgtttc
aaacacatcattgaacctaagtgggaggatcctatttgtgctaatggaggaaaatggact
atgactttccctaaggagaagtctgataagagctggctctacactttgcttgcattgatt
ggagagcagtttgatcatggagatgaaatatgtggagcagttgtcaacattagaggaaag
caagaaaggatatctatttggactaaaaatgcttcaaacgaagctgctcaggtgagcatt
ggaaaacaatggaaggagtttctcgattacaacaacagcataggtttcatcatccatgag
gatgcgaagaagctcgacaggaatgcaaagaacgcttacaccgcttga

DBGET integrated database retrieval system