KEGG   Arabidopsis thaliana (thale cress): AT4G18040Help
Entry
AT4G18040         CDS       T00041                                 

Gene name
EIF4E
Definition
translation initiation factor eIF-4E
Orthology
K03259  
translation initiation factor 4E
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
RNA transport
Module
eIF4F complex
Brite
KEGG Orthology (KO) [BR:ath00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    AT4G18040 (EIF4E)
Messenger RNA biogenesis [BR:ath03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     AT4G18040 (EIF4E)
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     AT4G18040 (EIF4E)
Translation factors [BR:ath03012]
 Eukaryotic Type
  Initiation factors
   eIF-4
    AT4G18040 (EIF4E)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
4
AA seq 235 aa AA seqDB search
MAVEDTPKSVVTEEAKPNSIENPIDRYHEEGDDAEEGEIAGGEGDGNVDESSKSGVPESH
PLEHSWTFWFDNPAVKSKQTSWGSSLRPVFTFSTVEEFWSLYNNMKHPSKLAHGADFYCF
KHIIEPKWEDPICANGGKWTMTFPKEKSDKSWLYTLLALIGEQFDHGDEICGAVVNIRGK
QERISIWTKNASNEAAQVSIGKQWKEFLDYNNSIGFIIHEDAKKLDRNAKNAYTA
NT seq 708 nt NT seq  +upstreamnt  +downstreamnt
atggcggtagaagacactcccaaatctgttgtaacggaagaagctaagcctaattcaata
gagaatccgattgatcgataccatgaggaaggtgatgatgccgaagaaggagagatcgcc
ggaggagaaggagacggaaacgttgacgaatcgagcaaatccggtgttcctgaatcgcat
cctctggaacattcatggactttctggttcgataatcctgctgtgaaatcgaaacaaacc
tcttggggaagttccttgcgacccgtgtttacgttttcaactgttgaggaattttggagt
ttgtacaacaacatgaagcatccgagcaagttagctcacggagctgacttctactgtttc
aaacacatcattgaacctaagtgggaggatcctatttgtgctaatggaggaaaatggact
atgactttccctaaggagaagtctgataagagctggctctacactttgcttgcattgatt
ggagagcagtttgatcatggagatgaaatatgtggagcagttgtcaacattagaggaaag
caagaaaggatatctatttggactaaaaatgcttcaaacgaagctgctcaggtgagcatt
ggaaaacaatggaaggagtttctcgattacaacaacagcataggtttcatcatccatgag
gatgcgaagaagctcgacaggaatgcaaagaacgcttacaccgcttga

DBGET integrated database retrieval system