KEGG   Arabidopsis thaliana (thale cress): AT4G18130Help
Entry
AT4G18130         CDS       T00041                                 

Gene name
PHYE
Definition
(RefSeq) phytochrome E
  KO
K12123  
phytochrome E
Organism
ath  Arabidopsis thaliana (thale cress)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
4
AA seq 1112 aa AA seqDB search
MGFESSSSAASNMKPQPQKSNTAQYSVDAALFADFAQSIYTGKSFNYSKSVISPPNHVPD
EHITAYLSNIQRGGLVQPFGCLIAVEEPSFRILGLSDNSSDFLGLLSLPSTSHSGEFDKV
KGLIGIDARTLFTPSSGASLSKAASFTEISLLNPVLVHSRTTQKPFYAILHRIDAGIVMD
LEPAKSGDPALTLAGAVQSQKLAVRAISRLQSLPGGDIGALCDTVVEDVQRLTGYDRVMV
YQFHEDDHGEVVSEIRRSDLEPYLGLHYPATDIPQAARFLFKQNRVRMICDCNATPVKVV
QSEELKRPLCLVNSTLRAPHGCHTQYMANMGSVASLALAIVVKGKDSSKLWGLVVGHHCS
PRYVPFPLRYACEFLMQAFGLQLQMELQLASQLAEKKAMRTQTLLCDMLLRDTVSAIVTQ
SPGIMDLVKCDGAALYYKGKCWLVGVTPNESQVKDLVNWLVENHGDDSTGLTTDSLVDAG
YPGAISLGDAVCGVAAAGFSSKDYLLWFRSNTASAIKWGGAKHHPKDKDDAGRMHPRSSF
TAFLEVAKSRSLPWEISEIDAIHSLRLIMRESFTSSRPVLSGNGVARDANELTSFVCEMV
RVIETATAPIFGVDSSGCINGWNKKTAEMTGLLASEAMGKSLADEIVQEESRAALESLLC
KALQGEEEKSVMLKLRKFGQNNHPDYSSDVCVLVNSCTSRDYTENIIGVCFVGQDITSEK
AITDRFIRLQGDYKTIVQSLNPLIPPIFASDENACCSEWNAAMEKLTGWSKHEVIGKMLP
GEVFGVFCKVKCQDSLTKFLISLYQGIAGDNVPESSLVEFFNKEGKYIEASLTANKSTNI
EGKVIRCFFFLQIINKESGLSCPELKESAQSLNELTYVRQEIKNPLNGIRFAHKLLESSE
ISASQRQFLETSDACEKQITTIIESTDLKSIEEGKLQLETEEFRLENILDTIISQVMIIL
RERNSQLRVEVAEEIKTLPLNGDRVKLQLILADLLRNIVNHAPFPNSWVGISISPGQELS
RDNGRYIHLQFRMIHPGKGLPSEMLSDMFETRDGWVTPDGLGLKLSRKLLEQMNGRVSYV
REDERCFFQVDLQVKTMLGVESRGTEGSSSIK
NT seq 3339 nt NT seq  +upstreamnt  +downstreamnt
atgggattcgagagttcaagctcagctgcaagcaacatgaaacctcaacctcaaaaatcc
aacactgctcaatactctgttgatgctgctctctttgctgatttcgctcaatccatttac
accggcaagtcttttaactactccaaatctgttatttcacctcccaatcacgttcctgat
gaacacatcacagcttacttgtctaacatccaaagaggcggtctagttcagccctttggt
tgtttgattgctgtcgaagaacctagttttaggatacttggtcttagtgacaactcttct
gactttcttggtttgttgtctcttccttccacctcccattctggtgagtttgataaagtc
aagggtttgattggaatcgatgcaaggacgctttttactccttcctctggagcttctttg
tctaaagctgcttcctttactgagatttccttgttgaatcctgttttggtccattctagg
acgacccagaagcctttttatgctattcttcacaggattgatgcagggattgtcatggat
ttggagcctgctaaatcaggtgatccggctttgacccttgcaggcgcagttcagtctcag
aagctagccgttagggccatttctaggctgcagtcacttcccggaggagatattggtgcc
ttgtgtgatactgttgtggaagatgttcagagacttaccggttatgaccgtgttatggtc
tatcagtttcatgaagatgatcatggtgaagttgtttctgagattagaaggtctgatttg
gagccttatttgggtttacattatccggcaacagatattcctcaggctgctcggttcttg
ttcaaacagaaccgtgtccgaatgatttgtgactgcaatgcaactccggttaaggttgtt
cagagtgaggaactcaagagaccactttgtttagttaattctactctaagagctcctcat
ggctgccatacgcagtatatggcgaatatgggctctgtagcttctcttgcactcgcaatt
gtagtaaaaggcaaagattcgagcaagctttggggattagttgttggtcatcattgttct
cctagatacgttccattcccgttgcggtatgcttgtgagtttctgatgcaagcatttggg
cttcagcttcaaatggaacttcagttagcatcacagttagccgagaagaaggctatgcgg
acgcagaccttgttgtgcgatatgcttctccgtgatactgtttccgctattgttacacaa
tctccgggtattatggaccttgtgaaatgtgatggagctgcgttatattacaaggggaaa
tgttggttggttggtgttactcctaatgagtcacaagttaaagacttggtgaattggctg
gtggagaatcacggtgatgattcgacgggtttaaccactgatagtttggtggatgcggga
taccctggtgccatctcacttggagatgccgtttgtggtgtggctgccgcaggattttct
tcaaaagattacttactttggttcaggtccaatactgcaagtgcaatcaaatggggagga
gctaaacatcatccaaaggataaagatgatgccggaagaatgcatccgaggtcatcgttt
acagcctttcttgaagttgcgaagagcaggagcttgccgtgggaaatctcagaaattgat
gctatccattccctgagacttataatgagagagtcatttaccagctctaggccagttttg
tctggtaatggcgtagcaagagatgctaatgagcttacttcttttgtgtgtgaaatggtt
agggtgattgaaaccgcaactgcacctatttttggggttgattcatccggatgtattaat
ggttggaacaagaaaaccgctgaaatgacgggattactagctagtgaagcaatggggaag
tcacttgccgatgagattgttcaagaggaatcacgcgcagctcttgaaagtctcttgtgc
aaagccctacaaggtgaagaggagaaaagtgtaatgctgaaactgagaaagtttggtcaa
aacaatcatccggattattcttctgatgtgtgtgttctcgttaactcctgcacgagtcgg
gattatactgaaaatatcatcggtgtctgcttcgttggtcaagacatcactagtgagaaa
gcaataacagatagattcatcagattgcaaggagattacaagactattgttcaaagctta
aatcctttgattccaccgatatttgcttcagatgaaaatgcttgttgttctgagtggaac
gcagcaatggaaaagcttacgggatggtcaaaacacgaggtgattgggaaaatgctaccc
ggtgaagtctttggagtcttttgtaaagtgaaatgccaagattcgctcacaaagttcttg
atctctctgtaccaaggaattgctggtgataatgttcccgagagttcactggttgagttc
tttaataaggaagggaagtacatagaagcatccttaaccgcgaacaagagtacaaacatc
gaaggaaaagttataagatgtttcttcttcttgcagattatcaataaggaatcggggttg
agctgcccagaactgaaagagagcgctcaaagcctcaacgaattaacttacgtaagacaa
gaaatcaagaatcctctcaacggtatccgatttgcacataagcttcttgaatcctcagag
atttcagctagccaaaggcagtttctggagactagtgatgcttgtgagaagcaaatcacg
acaataatcgaaagcacggacttgaaaagcattgaggaaggcaagttgcaattggaaaca
gaagagtttcgacttgaaaacatcttggacacaatcattagccaagtgatgattatattg
agagagaggaactcacaactaagggttgaagtcgccgaggagatcaaaactctgcctctc
aatggtgacagagtcaagctccagcttattcttgctgatcttctacgcaacattgtgaat
catgcgccgtttccaaatagttgggtaggtatcagtatctcaccagggcaggagctttca
cgtgacaatggtcgctatatccatctacagttcaggatgatacatccggggaaaggactt
ccttcagagatgctaagtgatatgtttgagactcgagatggatgggtcacccctgatggt
ttagggcttaagctttcgcggaaactattggagcagatgaatggccgtgtgagttatgtc
cgagaagacgaacggtgtttctttcaggtggatcttcaagtgaagacaatgttaggtgtt
gagtcaagaggaacagagggtagttcaagcataaagtag

DBGET integrated database retrieval system