KEGG   Arabidopsis thaliana (thale cress): AT4G18480Help
Entry
AT4G18480         CDS       T00041                                 

Gene name
CHLI1
Definition
magnesium-chelatase subunit chlI
Orthology
K03405  
magnesium chelatase subunit I [EC:6.6.1.1]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ath00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    AT4G18480 (CHLI1)
Enzymes [BR:ath01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     AT4G18480 (CHLI1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
4
AA seq 424 aa AA seqDB search
MASLLGTSSSAIWASPSLSSPSSKPSSSPICFRPGKLFGSKLNAGIQIRPKKNRSRYHVS
VMNVATEINSTEQVVGKFDSKKSARPVYPFAAIVGQDEMKLCLLLNVIDPKIGGVMIMGD
RGTGKSTTVRSLVDLLPEINVVAGDPYNSDPIDPEFMGVEVRERVEKGEQVPVIATKINM
VDLPLGATEDRVCGTIDIEKALTEGVKAFEPGLLAKANRGILYVDEVNLLDDHLVDVLLD
SAASGWNTVEREGISISHPARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDADLRVK
IVEERARFDSNPKDFRDTYKTEQDKLQDQISTARANLSSVQIDRELKVKISRVCSELNVD
GLRGDIVTNRAAKALAALKGKDRVTPDDVATVIPNCLRHRLRKDPLESIDSGVLVSEKFA
EIFS
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
atggcgtctcttcttggaacatcttcttctgcaatctgggcttctccttcactctcttct
ccttcctcaaaaccttcctcctcccccatttgcttcaggccaggaaaattgtttggaagc
aagttaaatgcaggaatccaaataaggccaaagaagaacaggtctcgttaccatgtttcg
gttatgaatgtagccactgaaatcaactctactgaacaagtagtagggaagtttgattca
aagaagagtgcgagaccggtttatccatttgcagctatagtagggcaagatgagatgaag
ttatgtcttttgttgaatgttattgatccaaagattggtggtgttatgattatgggagat
agaggaactggaaaatctacaactgttagatcattagttgatctgttacctgagattaat
gtagttgcaggtgacccgtataactcggatccgatagatcctgagtttatgggtgttgaa
gtaagagagagagttgagaaaggagagcaagttcctgttattgcgactaagattaatatg
gttgatcttcctttgggtgcaacagaagatagagtttgtggaaccatcgatatcgaaaag
gctttgacagaaggtgtaaaagcctttgagcctggtttgttggctaaagctaatagaggg
attctttatgttgatgaagttaatctcttggatgatcatttggttgatgttcttttggat
tcagctgcttctggttggaatacggttgagagagaagggatttcgatttctcacccggcg
aggtttatcttgatcggttcaggaaatccggaagaaggagagcttaggccacagcttctt
gatcggtttggtatgcatgcacaagtagggacggttagagatgctgatttacgggtcaag
attgttgaagagagagctcgtttcgatagtaacccaaaggatttccgtgacacttacaaa
accgagcaggacaagcttcaagaccagatttcaactgctagggcaaacctttcctcggtt
cagattgatagggaattgaaggtgaagatctctagagtttgttcagagctcaatgttgat
gggttgagaggagacatagtgactaacagagcagcaaaagcacttgcagctctcaaagga
aaagatcgagtaactccagatgatgttgcaaccgttatccctaactgcttaaggcaccgt
ctgaggaaagatccactggaatctattgattcaggagttctagtttccgagaagttcgcc
gagattttcagctga

DBGET integrated database retrieval system