KEGG   Arabidopsis thaliana (thale cress): AT4G19210Help
Entry
AT4G19210         CDS       T00041                                 

Gene name
ABCE2
Definition
(RefSeq) RNAse l inhibitor protein 2
  KO
K06174  
ATP-binding cassette, sub-family E, member 1
Organism
ath  Arabidopsis thaliana (thale cress)
Brite
Ribosome biogenesis [BR:ath03009]
 Eukaryotic Type
  Pre-40S particles
   Other pre-40S particles
    AT4G19210 (ABCE2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
MIPS: 
TAIR: 
Araport: 
UniProt: 
Position
4
AA seq 605 aa AA seqDB search
MADRLTRIAIVSSDRCKPKKCRQECKKSCPVVKTGKLCIEVTVGSKLAFISEELCIGCGI
CVKKCPFEAIQIINLPRDLEKDTTHRYGANTFKLHRLPVPRPGQVLGLVGTNGIGKSTAL
KILAGKLKPNLGRFTSPPDWQEILTHFRGSELQNYFTRILEDNLKAIIKPQYVDHIPRAV
KGNVGEVLDQKDERDKKAELCADLELNQVIDRDVENLSGGELQRFAIAVVAIQNAEIYMF
DEPSSYLDVKQRLKAAQVVRSLLRPNSYVIVVEHDLSVLDYLSDFICCLYGKPGAYGVVT
LPFSVREGINIFLAGFVPTENLRFRDESLTFKVAETPQESAEEIQSYARYKYPTMTKTQG
NFRLRVSEGEFTDSQIIVMLGENGTGKTTFIRMLAGLLKPDDTEGPDREIPEFNVSYKPQ
KISPKFQNSVRHLLHQKIRDSYMHPQFMSDVMKPLQIEQLMDQEVVNLSGGELQRVALTL
CLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIMATYLADRVIV
YEGQPSIDCTANCPQSLLSGMNLFLSHLNITFRRDPTNFRPRINKLESTKDREQKSAGSY
YYLDD
NT seq 1818 nt NT seq  +upstreamnt  +downstreamnt
atggcagatcgattgacacgtattgctattgtgagttcagaccgttgcaagccaaagaaa
tgtcgccaagagtgcaagaagagttgtcctgtggtcaagacaggaaaactttgtattgag
gtgactgttggttccaagcttgcttttatctcagaggagttgtgtatcggttgcggtatt
tgtgtgaagaaatgcccgtttgaagctattcagattatcaatcttccaagagacttggag
aaagatacgacccatcgttatggggcaaacacttttaagttacacaggctcccagttcca
agaccagggcaggtgctagggttggttggaaccaatggtattggaaaatcaactgctctg
aaaattttggctggaaagctcaaaccaaatttgggccgtttcactagtcctccagactgg
caagaaatcttgactcacttccgtggttcagaacttcaaaactacttcacacgtattcta
gaagataatcttaaggccattataaagcctcaatatgtcgaccacatcccaagagcagtt
aaaggcaatgttggagaggtccttgaccagaaggatgagagagataagaaggcagagctc
tgtgctgatctggagctgaaccaggtcattgaccgtgatgttgagaatttatctggtggt
gagctgcagaggtttgcaatcgctgttgttgccatacaaaatgcagagatttacatgttt
gatgaaccatctagttacctcgatgttaagcaaagactcaaagctgctcaagttgttcgt
tctctcctgaggcctaatagctacgtcattgttgtggagcatgatctcagtgttcttgat
tacttgtcggatttcatttgctgtctgtatgggaaaccaggagcctatggtgtggtgact
ctccccttctctgtcagagaaggaatcaacattttcttggctggatttgttcctacagaa
aatttacgttttagagatgaatctttgaccttcaaggttgctgagactccacaagaaagt
gctgaagagatacagtcgtacgctaggtacaaataccccacgatgaccaaaactcaagga
aacttcaggttgagagtgtcggaaggtgaattcactgactctcagattattgtaatgctt
ggggagaatggtacagggaagacaacatttattcggatgctggccgggttgttgaaacca
gacgacacagaaggaccagacagagagataccagaattcaatgtttcgtataagccacaa
aagatcagcccaaagtttcagaattcagttaggcacctgctacatcaaaagattcgagat
tcttacatgcatccacaatttatgtcggatgtgatgaaaccacttcagattgagcagttg
atggatcaagaagttgtcaatctctcaggaggagaattgcaaagggttgcattaactctg
tgcctcggaaagcctgcggatatatacctgatcgatgagccaagtgcatatctcgattct
gagcaacgtattgttgcttctaaagtcataaagcgatttattctccacgcaaagaaaact
gcatttgtagtcgagcatgactttataatggcgacctatttggcagaccgggtcattgtg
tatgaaggacaaccatccattgattgtactgcaaattgtcctcaatcactgctcagtgga
atgaatctcttcttatctcatctgaacatcacattcagacgggatcccaccaatttcaga
ccaagaatcaacaaattggagtcgaccaaagacagggaacagaagtctgcaggctcatac
tactacttggatgattag

DBGET integrated database retrieval system