KEGG   Arabidopsis thaliana (thale cress): AT4G21280Help
Entry
AT4G21280         CDS       T00041                                 

Gene name
PSBQA
Definition
oxygen evolving complex of photosystem II subunit PsbQ
Orthology
K08901  
photosystem II oxygen-evolving enhancer protein 3
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
Photosynthesis
Metabolic pathways
Class
Metabolism; Energy metabolism; Photosynthesis [PATH:ath00195]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
4
AA seq 224 aa AA seqDB search
MASMGGLHGASPAVLEGSLKINGSSRLNGSGRVAVAQRSRLVVRAQQSEETSRRSVIGLV
AAGLAGGSFVQAVLADAISIKVGPPPAPSGGLPAGTDNSDQARDFALALKDRFYLQPLPP
TEAAARAKESAKDIINVKPLIDRKAWPYVQNDLRSKASYLRYDLNTIISSKPKDEKKSLK
DLTTKLFDTIDNLDYAAKKKSPSQAEKYYAETVSALNEVLAKLG
NT seq 675 nt NT seq  +upstreamnt  +downstreamnt
atggcttcgatgggtggattacacggtgcatctccggcggttcttgaaggaagcttaaag
atcaatggctccagccgtctgaatggctctggaagagtggcggtggctcaaaggtctaga
cttgtcgtcagagctcagcagagtgaggagacttctcgccggtccgtgattgggcttgtt
gctgctggtttagctggtggctcgtttgttcaggctgtcctcgccgatgctatttcgatc
aaagttggccctcctccagctccttccggtggccttccagctgggacagataactcagac
caagcaagagactttgcattggcattgaaagacaggttttacttacagccattgccacca
acagaagctgcagctagagccaaagaatctgcaaaggatatcataaatgtgaagccattg
atcgacaggaaagcttggccatatgttcaaaacgatcttcgttccaaggcttcttatctt
cgttatgatcttaacacaatcatttcctccaaacccaaggatgagaagaagtcactcaag
gatctcaccaccaagctcttcgataccatcgacaatctggattatgcggcgaagaagaag
agtccttcgcaggctgagaagtactatgctgagacagtctctgctttgaacgaagttctt
gccaagcttggttaa

DBGET integrated database retrieval system