KEGG   Arabidopsis thaliana (thale cress): AT4G21280Help
Entry
AT4G21280         CDS       T00041                                 

Gene name
PSBQA
Definition
oxygen evolving complex of photosystem II subunit PsbQ
Orthology
K08901  
photosystem II oxygen-evolving enhancer protein 3
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
Photosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ath00001]
 Metabolism
  Energy metabolism
   00195 Photosynthesis
    AT4G21280 (PSBQA)
Photosynthesis proteins [BR:ath00194]
 Photosystem and electron transport system
  Photosystem II (P680 chlorophyll a) [OT]
   Other subunits in plants
    AT4G21280 (PSBQA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
4
AA seq 224 aa AA seqDB search
MASMGGLHGASPAVLEGSLKINGSSRLNGSGRVAVAQRSRLVVRAQQSEETSRRSVIGLV
AAGLAGGSFVQAVLADAISIKVGPPPAPSGGLPAGTDNSDQARDFALALKDRFYLQPLPP
TEAAARAKESAKDIINVKPLIDRKAWPYVQNDLRSKASYLRYDLNTIISSKPKDEKKSLK
DLTTKLFDTIDNLDYAAKKKSPSQAEKYYAETVSALNEVLAKLG
NT seq 675 nt NT seq  +upstreamnt  +downstreamnt
atggcttcgatgggtggattacacggtgcatctccggcggttcttgaaggaagcttaaag
atcaatggctccagccgtctgaatggctctggaagagtggcggtggctcaaaggtctaga
cttgtcgtcagagctcagcagagtgaggagacttctcgccggtccgtgattgggcttgtt
gctgctggtttagctggtggctcgtttgttcaggctgtcctcgccgatgctatttcgatc
aaagttggccctcctccagctccttccggtggccttccagctgggacagataactcagac
caagcaagagactttgcattggcattgaaagacaggttttacttacagccattgccacca
acagaagctgcagctagagccaaagaatctgcaaaggatatcataaatgtgaagccattg
atcgacaggaaagcttggccatatgttcaaaacgatcttcgttccaaggcttcttatctt
cgttatgatcttaacacaatcatttcctccaaacccaaggatgagaagaagtcactcaag
gatctcaccaccaagctcttcgataccatcgacaatctggattatgcggcgaagaagaag
agtccttcgcaggctgagaagtactatgctgagacagtctctgctttgaacgaagttctt
gccaagcttggttaa

DBGET integrated database retrieval system