KEGG   Arabidopsis thaliana (thale cress): AT4G21540Help
Entry
AT4G21540         CDS       T00041                                 

Gene name
SPHK1
Definition
sphingosine kinase 1
Orthology
K04718  
sphingosine kinase [EC:2.7.1.91]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
Sphingolipid metabolism
Metabolic pathways
Module
Sphingosine degradation
Brite
KEGG Orthology (KO) [BR:ath00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    AT4G21540 (SPHK1)
Enzymes [BR:ath01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.91  sphinganine kinase
     AT4G21540 (SPHK1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
4
AA seq 320 aa AA seqDB search
MDRQPERENDELPSPAIISDRVLVNGVVTPLTLTAEGELRSTESGRRKSTLAKEILSFVV
EGNKVRVKTLVEKGGGICCRGSAGDYARNDFVFEPLSDESRKLWSDKFHQHLVSLGRPKK
LLVFVNPFGGKKTARKIFQEEVKPLFEDANIQLEIQETKYQLHAKEIVRSMDVSKYDGIV
CVSGDGILVEVVNGLLEREDWKTAIKLPIGMVPAGSGNGMIKSLLEPVGLPCSATSATIS
IIRGRTRSLDVATISQGTTKFFSVLMLAWGLVADIDIESEKFRWMGSSEDNMLKTIPWTN
SICASSWVRKLWATSQLQYR
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atggatcgtcagccggagagggagaatgatgaactaccatctccggcgataatttccgac
cgagttctggtaaatggtgttgtcacgccgttaacgttgaccgccgagggagagctacga
tcgacggaatctggacggcggaaatcgacgttggcaaaagaaatcctgagtttcgtcgtg
gaaggtaacaaggttagagtaaagaccttggttgagaaaggaggaggaatttgctgtaga
ggaagtgctggagattatgcgaggaacgatttcgttttcgagcctctctctgatgaatct
agaaagctttggtccgataagttccatcaacacctcgtctctctcggtcggccaaagaaa
ttgcttgtgtttgtgaatccgtttggcgggaagaaaacagcgagaaagatatttcaagag
gaagtaaagccattgtttgaagatgcaaatattcaacttgagattcaagaaaccaagtat
cagttgcatgcaaaggaaattgttaggtccatggatgtatcaaaatacgatggtattgtt
tgtgttagcggtgacggtatccttgttgaggttgtaaatggactgcttgaaagagaagac
tggaagactgccataaaattgccgatcggaatggtccctgcaggaagtggtaatggcatg
attaaatcattgttggaaccggtagggcttccttgtagtgcaacaagtgctactatttcg
ataatccgaggtcgtacacgttctctagatgtagcaactatctcacaagggactaccaaa
ttcttcagtgtcttgatgcttgcttggggtttagtggctgatatagacatcgagtcagag
aaattcagatggatggggtcttcagaggataatatgcttaagacaataccatggacgaat
tctatttgtgccagctcctgggttcgaaagctatgggcaacgagccagttgcagtataga
taa

DBGET integrated database retrieval system