KEGG   Arabidopsis thaliana (thale cress): AT4G22870Help
Entry
AT4G22870         CDS       T00041                                 

Definition
leucoanthocyanidin dioxygenase-like protein
Orthology
K05277  
leucoanthocyanidin dioxygenase [EC:1.14.11.19]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
Flavonoid biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Flavonoid biosynthesis, naringenin => pelargonidin
Class
Metabolism; Biosynthesis of other secondary metabolites; Flavonoid biosynthesis [PATH:ath00941]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
4
AA seq 153 aa AA seqDB search
MSISTQINYDTSIIRGFLSQDDVIVGDMTVEKHRIPRKYIRGMNLKDLFYEGKWVTAKCV
PNSIVMHIGDTLEILSNGKYKSILHRGLVNKEKVRISWAVFCEPPKDKIVLKPLPDMVSV
ESPAKFPPRTFAQHIEHKLFGKEQEELVSEKKD
NT seq 462 nt NT seq  +upstreamnt  +downstreamnt
atgtcaatatccacacaaatcaattatgatacatctattattagaggtttccttagccaa
gatgatgtgatagtaggtgacatgacggtagagaaacataggataccaaggaaatacata
agaggaatgaatttgaaagatctattctacgagggcaaatgggtcactgcaaaatgtgtt
cctaattcgattgtgatgcacattggagatactttggagattcttagtaatgggaagtat
aagagtatacttcatcgtgggttggtgaataaggagaaggttaggatttcttgggctgtg
ttttgtgagccaccaaaggataagattgttcttaagccgttgcctgatatggtgagtgtt
gagtctccggctaagtttcctccaaggacatttgctcaacatattgagcataagttgttt
ggaaaggaacaagaggaattggtgtctgagaaaaaggattaa

DBGET integrated database retrieval system