KEGG   Arabidopsis thaliana (thale cress): AT4G22880Help
Entry
AT4G22880         CDS       T00041                                 

Gene name
LDOX
Definition
leucoanthocyanidin dioxygenase
Orthology
K05277  
leucoanthocyanidin dioxygenase [EC:1.14.11.19]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
Flavonoid biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Flavonoid biosynthesis, naringenin => pelargonidin
Brite
KEGG Orthology (KO) [BR:ath00001]
 Metabolism
  Biosynthesis of other secondary metabolites
   00941 Flavonoid biosynthesis
    AT4G22880 (LDOX)
Enzymes [BR:ath01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.11  With 2-oxoglutarate as one donor, and incorporation of one atom of oxygen into each donor
    1.14.11.19  leucocyanidin oxygenase
     AT4G22880 (LDOX)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Structure
PDB: 

Jmol
Position
4
AA seq 356 aa AA seqDB search
MVAVERVESLAKSGIISIPKEYIRPKEELESINDVFLEEKKEDGPQVPTIDLKNIESDDE
KIRENCIEELKKASLDWGVMHLINHGIPADLMERVKKAGEEFFSLSVEEKEKYANDQATG
KIQGYGSKLANNASGQLEWEDYFFHLAYPEEKRDLSIWPKTPSDYIEATSEYAKCLRLLA
TKVFKALSVGLGLEPDRLEKEVGGLEELLLQMKINYYPKCPQPELALGVEAHTDVSALTF
ILHNMVPGLQLFYEGKWVTAKCVPDSIVMHIGDTLEILSNGKYKSILHRGLVNKEKVRIS
WAVFCEPPKDKIVLKPLPEMVSVESPAKFPPRTFAQHIEHKLFGKEQEELVSEKND
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atggttgcggttgaaagagttgagagtctagcaaaaagcggaatcatatcgattccaaaa
gaatatattcgtccaaaagaagagctcgagagcatcaacgatgttttcctagaagagaag
aaagaagacggtcctcaagttcccacaatcgatctaaagaacatcgagtcagacgatgaa
aagatccgtgagaattgtattgaggagctgaaaaaggcatctttggattggggagtgatg
catttgatcaaccatggaataccagctgatctaatggagcgtgtcaagaaagccggagaa
gagtttttcagtttgtctgtggaagagaaggagaagtatgcaaacgatcaagccactgga
aagattcaaggctatggaagtaaattggctaacaacgcgagtggacaattggaatgggaa
gattacttctttcatcttgcgtatcctgaagagaagagagatctatcaatttggcctaag
acaccaagtgattacatagaagcaacgagtgagtacgcgaagtgtcttcgtttgctagcg
actaaagtcttcaaggctctctctgtcggtctaggtttagagcctgaccgtctagagaaa
gaagttggtggtttagaagagcttcttctacaaatgaagataaattactatccaaaatgt
cctcagcctgagctagcactcggtgtggaagctcacaccgatgtaagcgctttaactttc
attctacacaacatggttccgggtttgcagcttttctacgagggcaaatgggtcactgca
aaatgtgttcctgattcgattgtgatgcacattggggatactttggagattcttagtaat
gggaagtataagagtatacttcatcgtgggttggtgaataaggagaaggttaggatttct
tgggctgtgttttgtgaacccccaaaggataagattgttcttaagccgttgccggagatg
gtgagtgttgagtctccggctaagtttcctccacggacttttgctcaacatattgagcat
aagttgtttgggaaggaacaagaggaattggtatccgagaaaaatgattaa

DBGET integrated database retrieval system