KEGG   Arabidopsis thaliana (thale cress): AT4G22880Help
Entry
AT4G22880         CDS       T00041                                 

Gene name
LDOX
Definition
(RefSeq) leucoanthocyanidin dioxygenase
  KO
K05277  anthocyanidin synthase [EC:1.14.20.4]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath00941  Flavonoid biosynthesis
ath01100  Metabolic pathways
ath01110  Biosynthesis of secondary metabolites
Module
ath_M00138  Flavonoid biosynthesis, naringenin => pelargonidin
Brite
KEGG Orthology (KO) [BR:ath00001]
 Metabolism
  Biosynthesis of other secondary metabolites
   00941 Flavonoid biosynthesis
    AT4G22880 (LDOX)
Enzymes [BR:ath01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.20  With 2-oxoglutarate as one donor, and the other dehydrogenated
    1.14.20.4  anthocyanidin synthase
     AT4G22880 (LDOX)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 2OG-FeII_Oxy DIOX_N
Motif
Other DBs
NCBI-GeneID: 828387
NCBI-ProteinID: NP_001031700
MIPS: AT4G22880.1
TAIR: AT4G22880
Araport: AT4G22880
UniProt: Q96323 Q0WWD6
Structure
PDB: 

Jmol
Position
4
AA seq 356 aa AA seqDB search
MVAVERVESLAKSGIISIPKEYIRPKEELESINDVFLEEKKEDGPQVPTIDLKNIESDDE
KIRENCIEELKKASLDWGVMHLINHGIPADLMERVKKAGEEFFSLSVEEKEKYANDQATG
KIQGYGSKLANNASGQLEWEDYFFHLAYPEEKRDLSIWPKTPSDYIEATSEYAKCLRLLA
TKVFKALSVGLGLEPDRLEKEVGGLEELLLQMKINYYPKCPQPELALGVEAHTDVSALTF
ILHNMVPGLQLFYEGKWVTAKCVPDSIVMHIGDTLEILSNGKYKSILHRGLVNKEKVRIS
WAVFCEPPKDKIVLKPLPEMVSVESPAKFPPRTFAQHIEHKLFGKEQEELVSEKND
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atggttgcggttgaaagagttgagagtctagcaaaaagcggaatcatatcgattccaaaa
gaatatattcgtccaaaagaagagctcgagagcatcaacgatgttttcctagaagagaag
aaagaagacggtcctcaagttcccacaatcgatctaaagaacatcgagtcagacgatgaa
aagatccgtgagaattgtattgaggagctgaaaaaggcatctttggattggggagtgatg
catttgatcaaccatggaataccagctgatctaatggagcgtgtcaagaaagccggagaa
gagtttttcagtttgtctgtggaagagaaggagaagtatgcaaacgatcaagccactgga
aagattcaaggctatggaagtaaattggctaacaacgcgagtggacaattggaatgggaa
gattacttctttcatcttgcgtatcctgaagagaagagagatctatcaatttggcctaag
acaccaagtgattacatagaagcaacgagtgagtacgcgaagtgtcttcgtttgctagcg
actaaagtcttcaaggctctctctgtcggtctaggtttagagcctgaccgtctagagaaa
gaagttggtggtttagaagagcttcttctacaaatgaagataaattactatccaaaatgt
cctcagcctgagctagcactcggtgtggaagctcacaccgatgtaagcgctttaactttc
attctacacaacatggttccgggtttgcagcttttctacgagggcaaatgggtcactgca
aaatgtgttcctgattcgattgtgatgcacattggggatactttggagattcttagtaat
gggaagtataagagtatacttcatcgtgggttggtgaataaggagaaggttaggatttct
tgggctgtgttttgtgaacccccaaaggataagattgttcttaagccgttgccggagatg
gtgagtgttgagtctccggctaagtttcctccacggacttttgctcaacatattgagcat
aagttgtttgggaaggaacaagaggaattggtatccgagaaaaatgattaa

DBGET integrated database retrieval system