KEGG   Arabidopsis thaliana (thale cress): AT4G22950Help
Entry
AT4G22950         CDS       T00041                                 

Gene name
AGL19
Definition
(RefSeq) AGAMOUS-like 19
Organism
ath  Arabidopsis thaliana (thale cress)
SSDB OrthologParalogGFIT
Motif
Pfam: SRF-TF K-box CENP-K Seryl_tRNA_N O-antigen_lig DNA_topoisoIV ZapB
Motif
Other DBs
NCBI-GeneID: 828394
NCBI-ProteinID: NP_001320037
MIPS: AT4G22950.1
TAIR: AT4G22950
Araport: AT4G22950
UniProt: O82743 A0A178V3F3
Position
4
AA seq 219 aa AA seqDB search
MVRGKTEMKRIENATSRQVTFSKRRNGLLKKAFELSVLCDAEVALVIFSPRSKLYEFSSS
SIAATIERYQRRIKEIGNNHKRNDNSQQARDETSGLTKKIEQLEISKRKLLGEGIDACSI
EELQQLENQLDRSLSRIRAKKYQLLREEIEKLKAEERNLVKENKDLKEKWLGMGTATIAS
SQSTLSSSEVNIDDNMEVETGLFIGPPETRQSKKFPPQN
NT seq 660 nt NT seq  +upstreamnt  +downstreamnt
atggtgaggggcaaaacggagatgaagaggatagagaacgcaacaagcaggcaagtgacg
ttttcgaagagaagaaatggactcttgaagaaagccttcgaattatcggtcctttgtgat
gctgaagttgctttggttatcttctctccaagatccaaactctatgagttctctagctct
agtatagcagcaacaattgaacgctatcagagacgaataaaagaaattgggaataatcat
aagagaaatgataattctcagcaagcgagagacgaaacatctggattgacaaaaaagatt
gaacagctagagatatctaaacgaaaattgcttggagaaggcattgatgcatgttccatc
gaggagctgcaacagttagagaatcagttggaccgaagcttgagcaggataagagccaag
aagtaccaattactccgtgaagaaattgagaagttgaaggcagaggagaggaatctcgtt
aaggaaaataaagatctgaaggagaagtggcttggaatgggaacagcaacaatagcatca
tcacaatcaacgttatcatcatcagaagtgaacatagatgacaatatggaagtggagact
ggtttgttcattggacctcctgagacaagacaatccaaaaaattccctcctcaaaattaa

DBGET integrated database retrieval system