KEGG   Arabidopsis thaliana (thale cress): AT4G23730Help
Entry
AT4G23730         CDS       T00041                                 

Definition
(RefSeq) Galactose mutarotase-like superfamily protein
  KO
K01792  
glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
Glycolysis / Gluconeogenesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ath00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AT4G23730
Enzymes [BR:ath01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.15  glucose-6-phosphate 1-epimerase
     AT4G23730
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MIPS: 
TAIR: 
Position
4
AA seq 271 aa AA seqDB search
MIQISLHGGQVLSWKTDKGDELLFNSTKANLKPPHPVRGGIPICFPQFGTRGSLEQHGFA
RNKMWLVENNPPALPSFDSTGKAYVDLVLKSSDEDTMRIWPYSFEFHLRVSLALDGNLTL
ISRVRNINSKPFSFSIAYHTYFSISDISEVRLEGLETLDYLDNMHDRERFTEQGDALTFE
SEIDRVYLNSKDVVAIFDHERKRTFLIKKEGLPDVVVWNPWEKKARALTDLGDDEYRHML
CVDGAAIEKPITLKPGEEWTGKLHLSLVLST
NT seq 816 nt NT seq  +upstreamnt  +downstreamnt
atgattcagattagtttacatggaggacaagttctttcatggaagactgacaagggtgat
gaattgttattcaacagcaccaaggccaacttgaagcctccccatccggtacgaggagga
atccctatatgctttcctcagtttggaactcggggatcacttgagcaacacgggtttgca
agaaacaagatgtggcttgtagaaaacaatccacctgctttaccttcatttgactcaact
ggaaaagcctatgttgatttggtgcttaagtcatctgatgaagatacgatgaggatctgg
ccttacagctttgagtttcatctgagagtctcattggcattagatgggaacctaacactg
atatcacgagtcagaaacatcaattcaaagccttttagcttttccattgcttaccacact
tacttctccatttccgatattagtgaagttagacttgaagggctggaaactcttgactat
cttgataatatgcatgatagagagcggttcacagagcaaggcgatgcattaacctttgaa
tcagagatcgatagagtgtacctaaattctaaagacgtggttgccattttcgaccatgag
agaaaacgcacattcctcatcaagaaagaaggtctacctgatgtcgtggtatggaatcca
tgggagaagaaagcgagagcattgacggatttgggagatgatgagtatagacacatgttg
tgtgtggatggagcagccattgagaaacccatcaccttgaaaccgggtgaagaatggacc
gggaaattacatctctcgcttgttctttccacctaa

DBGET integrated database retrieval system