KEGG   Arabidopsis thaliana (thale cress): AT4G23730Help
Entry
AT4G23730         CDS       T00041                                 

Definition
galactose mutarotase-like superfamily protein
Orthology
K01792  
glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
Glycolysis / Gluconeogenesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:ath00010]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
4
AA seq 306 aa AA seqDB search
MEPSSGTGPEKRPTVDLVKDRNGTDQILLQNPRGASVKISLHGGQVLSWKTDKGDELLFN
STKANLKPPHPVRGGIPICFPQFGTRGSLEQHGFARNKMWLVENNPPALPSFDSTGKAYV
DLVLKSSDEDTMRIWPYSFEFHLRVSLALDGNLTLISRVRNINSKPFSFSIAYHTYFSIS
DISEVRLEGLETLDYLDNMHDRERFTEQGDALTFESEIDRVYLNSKDVVAIFDHERKRTF
LIKKEGLPDVVVWNPWEKKARALTDLGDDEYRHMLCVDGAAIEKPITLKPGEEWTGKLHL
SLVLST
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atggaaccatcatctggaaccggtcctgagaagagaccaaccgttgacttggtcaaggat
agaaatggaacggatcagattcttcttcagaatcctagaggcgcctctgtaaagattagt
ttacatggaggacaagttctttcatggaagactgacaagggtgatgaattgttattcaac
agcaccaaggccaacttgaagcctccccatccggtacgaggaggaatccctatatgcttt
cctcagtttggaactcggggatcacttgagcaacacgggtttgcaagaaacaagatgtgg
cttgtagaaaacaatccacctgctttaccttcatttgactcaactggaaaagcctatgtt
gatttggtgcttaagtcatctgatgaagatacgatgaggatctggccttacagctttgag
tttcatctgagagtctcattggcattagatgggaacctaacactgatatcacgagtcaga
aacatcaattcaaagccttttagcttttccattgcttaccacacttacttctccatttcc
gatattagtgaagttagacttgaagggctggaaactcttgactatcttgataatatgcat
gatagagagcggttcacagagcaaggcgatgcattaacctttgaatcagagatcgataga
gtgtacctaaattctaaagacgtggttgccattttcgaccatgagagaaaacgcacattc
ctcatcaagaaagaaggtctacctgatgtcgtggtatggaatccatgggagaagaaagcg
agagcattgacggatttgggagatgatgagtatagacacatgttgtgtgtggatggagca
gccattgagaaacccatcaccttgaaaccgggtgaagaatggaccgggaaattacatctc
tcgcttgttctttccacctaa

DBGET integrated database retrieval system