KEGG   Arabidopsis thaliana (thale cress): AT4G24660Help
Entry
AT4G24660         CDS       T00041                                 

Gene name
HB22
Definition
(RefSeq) ZF-HD homeobox protein
Organism
ath  Arabidopsis thaliana (thale cress)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Structure
PDB: 

Jmol
Position
4
AA seq 220 aa AA seqDB search
MNFEDQEEDMEMSGVNPPCGYDSLSGEGATSSGGGGVGRSKGVGAKIRYRECLKNHAVNI
GGHAVDGCCEFMPSGEDGTLDALKCAACGCHRNFHRKETESIGGRAHRVPTYYNRPPQPH
QPPGYLHLTSPAAPYRPPAASGDEEDTSNPSSSGGTTKRFRTKFTAEQKEKMLAFAERLG
WRIQKHDDVAVEQFCAETGVRRQVLKIWMHNNKNSLGKKP
NT seq 663 nt NT seq  +upstreamnt  +downstreamnt
atgaattttgaggatcaagaagaagatatggagatgtcaggtgttaatcccccctgcggt
tacgactctctaagcggtgagggagccacatctagtggtggtggaggagtaggaaggagt
aaaggagttggagcgaagataaggtatagagagtgcttgaagaaccatgctgttaacata
ggtggccacgccgtggacggttgttgcgagtttatgccttccggtgaagatggaacgctc
gacgctcttaagtgtgcagcttgcggctgccaccgcaacttccaccgcaaggaaaccgaa
agcatcggcggtagagcccacagagttcccacgtactacaaccgcccgccgcagccgcat
cagccgcctggatatcttcatctaacatctcccgcggcgccttacaggccacccgcggca
tcgggggacgaggaggatacatcaaatcctagcagcagcggcgggaccacgaagaggttt
agaacgaagttcacggcggaacagaaagagaagatgttagcctttgcggagaggttgggg
tggagaattcagaagcatgatgacgtggcggttgagcagttctgtgcggagactggtgtt
aggagacaagtgcttaaaatctggatgcataacaacaagaactctcttggtaagaaaccc
taa

DBGET integrated database retrieval system