KEGG   Arabidopsis thaliana (thale cress): AT4G24740Help
Entry
AT4G24740         CDS       T00041                                 

Gene name
FC2
Definition
LAMMER-type protein kinase AFC2
Orthology
K08287  
dual-specificity kinase [EC:2.7.12.1]
Organism
ath  Arabidopsis thaliana (thale cress)
Brite
Enzymes [BR:ath01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     AT4G24740 (FC2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
4
AA seq 427 aa AA seqDB search
MEMERVHEFPHTHMDRRPRKRARLGWDVLPQATKAQVGMFCGQEIGNISSFASSGAPSDN
SSSLCVKGVARNGSPPWREDDKDGHYIFELGDDLTPRYKIYSKMGEGTFGQVLECWDRER
KEMVAVKIVRGVKKYREAAMIEIEMLQQLGKHDKGGNRCVQIRNWFDYRNHICIVFEKLG
SSLYDFLRKNNYRSFPIDLVREIGWQLLECVAFMHDLRMIHTDLKPENILLVSSDYVKIP
EYKGSRLQRDVCYKRVPKSSAIKVIDFGSTTYERQDQTYIVSTRHYRAPEVILGLGWSYP
CDVWSVGCIIVELCTGEALFQTHENLEHLAMMERVLGPFPQQMLKKVDRHSEKYVRRGRL
DWPDGATSRDSLKAVLKLPRLQNLIMQHVDHSAGELINMVQGLLRFDPSERITAREALRH
PFFARRR
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atggagatggagcgtgtgcatgaattccctcatactcacatggatcgtcgtcccagaaag
agagcgcgtctcggttgggatgtgttgcctcaggcaaccaaggctcaggtaggaatgttt
tgtgggcaagagattggaaatatatcaagctttgcatcttccggagctccttcagacaat
agtagctctctttgtgttaagggtgtggctcgaaatggttctcccccatggcgagaagat
gataaggatggacattacatatttgaactgggagatgacttaactccacgctataaaatt
tatagcaaaatgggggaaggtacttttggtcaagtgctagaatgttgggatagggagagg
aaggaaatggtggcagtaaaaattgtccgtggtgtgaagaaataccgtgaggctgctatg
attgaaattgaaatgctgcaacagcttggtaaacatgacaaaggtggcaatcgttgtgta
caaattcggaactggtttgactatcgtaaccatatctgtattgtatttgagaagcttgga
tcgagtttatacgattttcttcggaaaaacaattatcgctcctttcccattgatcttgtc
cgtgagattggctggcaactcttggaatgtgtagcatttatgcatgacttgcgcatgatt
catacggaccttaaaccagaaaatattctgttagtctcctcagactatgtgaagattccc
gagtacaaggggtcccgattacaaagggatgtatgctataaaagagtgcctaaatcaagt
gcaataaaggtgattgattttggtagcacaacttatgagcgccaggaccaaacctacatt
gtatcaaccagacattatagggcaccagaagtcattttaggtcttggctggagttatccg
tgtgatgtttggagcgttggatgtatcatagtggagttgtgcacgggtgaagcattgttc
caaacacatgaaaacctggagcatctagcgatgatggagcgtgttcttgggccgtttcct
caacaaatgctgaagaaagtggaccggcactcagagaaatatgtgagaagaggtcgtttg
gattggccagatggggcaacctcaagagatagcctgaaggcagtattgaagcttcctcgg
cttcagaatttaataatgcaacatgtggaccactcagccggggagttaataaatatggtg
caaggacttctgcgatttgatccgtcagagagaataaccgctcgtgaagctctgaggcat
ccgtttttcgcaaggagaagatag

DBGET integrated database retrieval system