KEGG   Arabidopsis thaliana (thale cress): AT4G25130Help
Entry
AT4G25130         CDS       T00041                                 

Gene name
PMSR4
Definition
(RefSeq) peptide methionine sulfoxide reductase A4
  KO
K07304  
peptide-methionine (S)-S-oxide reductase [EC:1.8.4.11]
Organism
ath  Arabidopsis thaliana (thale cress)
Brite
Enzymes [BR:ath01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.4  With a disulfide as acceptor
    1.8.4.11  peptide-methionine (S)-S-oxide reductase
     AT4G25130 (PMSR4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
4
AA seq 258 aa AA seqDB search
MQVLVVSPPLIAAASLSKPLNSLSKAALSFSRAKPICPFPQTSRRPISVYKSPMNNLFNR
LGFGSRPQAQADPSSAAIAQGPDDDVPSSGQQFAQFGAGCFWGVELAYQRVPGVTKTEVG
YSHGIVHNPSYEDVCTGTTGHNEVVRVQYDPKECSFESLLDVFWNRHDPTTLNRQGGDVG
TQYRSGIYYYTDEQERIAREAVEKQQKILNKRIVTEILPATKFYRAENYHQQYLAKGGRM
GLRQSAEKGCKDPIRCYG
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atgcaggtcctcgtcgtctctcctccgctcatcgccgccgcatctctctctaaacctctc
aattctctctctaaagccgcactctctttctccagagccaaacccatttgtcctttccct
caaacctctcgacgaccaatctccgtatacaaatccccaatgaacaaccttttcaacaga
ctcggattcgggtctcgtcctcaagcccaagctgacccatcttccgccgcaatcgcccaa
ggacccgacgatgatgttccgtcttcaggtcagcaattcgcgcaatttggcgccggttgt
ttctggggagtggagctagcttaccagagagttcctggtgtgaccaagaccgaggttggg
tatagccatggcatcgtgcacaatccgagttacgaggatgtctgtactggcactacggga
cataacgaggttgttagagttcagtatgatcccaaagagtgtagctttgagagcttgctt
gatgttttctggaatcgtcatgatccaaccaccttgaatcgtcagggtggggatgtggga
acgcagtatcgatcaggtatatactactacacagacgagcaagagcgcatagctcgtgaa
gctgttgagaaacagcagaagatattgaacaagaggattgtcacagagatacttcccgct
acgaaattctacagagcagaaaattaccaccagcaatacctggcaaaagggggtcgcatg
ggtttaagacaatcagctgagaaaggttgcaaggatccaatccgatgctatggctaa

DBGET integrated database retrieval system