KEGG   Arabidopsis thaliana (thale cress): AT4G26070Help
Entry
AT4G26070         CDS       T00041                                 

Gene name
MEK1
Definition
(RefSeq) MAP kinase/ ERK kinase 1
  KO
K20602  mitogen-activated protein kinase kinase 1 [EC:2.7.12.2]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath04016  MAPK signaling pathway - plant
Brite
KEGG Orthology (KO) [BR:ath00001]
 Environmental Information Processing
  Signal transduction
   04016 MAPK signaling pathway - plant
    AT4G26070 (MEK1)
Enzymes [BR:ath01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     AT4G26070 (MEK1)
Protein kinases [BR:ath01001]
 Serine/threonine kinases: STE group
  STE7 family
   AT4G26070 (MEK1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like APH RIO1 Haspin_kinase Seadorna_VP7 Kdo
Motif
Other DBs
NCBI-GeneID: 828713
NCBI-ProteinID: NP_194337
MIPS: AT4G26070.1
TAIR: AT4G26070
Araport: AT4G26070
UniProt: Q94A06 A0A178V3F2
Position
4
AA seq 354 aa AA seqDB search
MNRGSLCPNPICLPPLEQSISKFLTQSGTFKDGDLRVNKDGIQTVSLSEPGAPPPIEPLD
NQLSLADLEVIKVIGKGSSGNVQLVKHKLTQQFFALKVIQLNTEESTCRAISQELRINLS
SQCPYLVSCYQSFYHNGLVSIILEFMDGGSLADLLKKVGKVPENMLSAICKRVLRGLCYI
HHERRIIHRDLKPSNLLINHRGEVKITDFGVSKILTSTSSLANSFVGTYPYMSPERISGS
LYSNKSDIWSLGLVLLECATGKFPYTPPEHKKGWSSVYELVDAIVENPPPCAPSNLFSPE
FCSFISQCVQKDPRDRKSAKELLEHKFVKMFEDSDTNLSAYFTDAGSLIPPLAN
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atgaacagaggaagcttatgccctaatcccatctgtctccctcctcttgagcaatccatc
tccaaattcttaacacagagtggaacgtttaaagatggagatcttcgagtgaacaaagat
ggaatccagaccgtgtctctgtccgaaccaggagctccacctcctattgagccattggac
aaccaattgagtttggcagatttagaagtgatcaaagtcattggcaaaggaagtagtggt
aatgtccagttggtcaaacacaaactcactcaacagtttttcgctcttaaggtcattcaa
ttgaacacagaagaatcaacatgtcgggcgatttctcaggagctgagaataaacttgagc
tcgcaatgtccatatcttgtctcatgttatcaatctttctaccacaacggtcttgtttca
atcatattggaattcatggatggtggatcccttgcagacttgttaaagaaagtcggaaaa
gttcctgaaaacatgctatctgccatctgcaagcgagttcttcgaggtctttgttatatt
catcatgagaggcgaatcattcatcgggacttaaagccttcaaacttgctaatcaatcat
agaggtgaagtcaagatcacagactttggtgtcagcaagatcttgacaagcacaagtagt
cttgctaattctttcgtgggcacatacccttatatgtctccagagagaatcagcgggagt
ttgtacagtaacaagagcgatatttggagcttgggactggttttgctcgaatgtgcaacg
ggtaaattcccgtatactcctccagaacacaagaaaggatggagtagcgtgtacgagctt
gtggacgccattgttgaaaacccgcctccttgtgcaccttccaatctcttttctccagag
ttttgctccttcatctcgcaatgtgtacaaaaagatccaagggacagaaaatcagcaaag
gagcttctggaacacaagttcgtaaagatgtttgaagattcggatacaaatctctcggct
tacttcaccgacgcaggatctttgattcccccacttgctaactag

DBGET integrated database retrieval system