KEGG   Arabidopsis thaliana (thale cress): AT4G26270Help
Entry
AT4G26270         CDS       T00041                                 

Gene name
PFK3
Definition
6-phosphofructokinase 3
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:ath00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    AT4G26270 (PFK3)
   01230 Biosynthesis of amino acids
    AT4G26270 (PFK3)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AT4G26270 (PFK3)
   00030 Pentose phosphate pathway
    AT4G26270 (PFK3)
   00051 Fructose and mannose metabolism
    AT4G26270 (PFK3)
   00052 Galactose metabolism
    AT4G26270 (PFK3)
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    AT4G26270 (PFK3)
Enzymes [BR:ath01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     AT4G26270 (PFK3)
Protein phosphatases and associated proteins [BR:ath01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     AT4G26270 (PFK3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
4
AA seq 489 aa AA seqDB search
MSTVESSKPKIINGSCGYVLEDVPHLSDYLPGLPTYPNPLQDNPAYSVVKQYFVDADDSV
PQKIVVHKDGPRGIHFRRAGPRQKVYFESDEVHACIVTCGGLCPGLNTVIREIVSSLSYM
YGVKRILGIDGGYRGFYAKNTVSLDSKVVNDIHKRGGTILGTSRGGHDTTKIVDSIQDRG
INQVYIIGGDGTQRGASVIFEEIRRRGLKVAVIGIPKTIDNDIPVIDKSFGFDTAVEEAQ
RAINAAHVEAESIENGIGVVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEGEGGLF
EYIEKRLKESGHMVLVIAEGAGQDLMSKSMESMTLKDASGNKLLKDVGLWLSQSIKDHFN
QKKMVMNLKYIDPTYMIRAVPSNASDNVYCTLLAQSAVHGAMAGYTGYISGLVNGRQTYI
PFYRITEKQNHVVITDRMWARLLSSTNQPSFLGPKDVFDNKEKPMSALLDDGNCNGVVDV
PPVTKEITK
NT seq 1470 nt NT seq  +upstreamnt  +downstreamnt
atgagtactgtggagagtagcaaaccgaagatcatcaatggctcttgtggttatgttcta
gaagatgtaccgcatctctccgattaccttcctggtcttcctacttatcctaatccattg
caagacaatccagcttactcagtggttaagcaatactttgttgatgctgatgacagtgtt
cctcaaaagatcgttgttcacaaggatggtccaagggggattcattttagacgagccggg
ccacgtcagaaggtatacttcgaatctgatgaagtgcatgcttgcatagttacctgtgga
ggtctttgtcctggccttaataccgtgattagagaaatagtgagcagtctatcttatatg
tatggagtgaagagaatactgggaatagatggtggatatagaggcttttatgctaagaat
actgtctccttggactctaaagttgtaaatgatatccataagcgtggagggactatcctt
gggacctcacgaggtggtcacgataccacaaagatagttgacagcattcaagatcgagga
atcaatcaggtttacattataggaggagatggaacacagcgaggagcatctgtcatattt
gaggaaattagaagacgtggcctgaaagttgcagttattggaatcccgaaaacaatcgat
aatgacatacctgtgatagacaaatcttttgggtttgacactgctgtagaagaggctcaa
cgagctattaatgcagcacatgtggaagccgagagtatagagaatggtatcggagttgtc
aagcttatgggtcgctacagcgggttcatagcgatgtatgccactctagcaagcagagat
gtggactgctgtttgattccggagtcaccattttacctggaaggagaaggcggactgttt
gagtacatagagaaacgactcaaggagagcggtcacatggttcttgtgattgcagaaggt
gcaggacaagatctaatgtcgaagagcatggaatctatgacactcaaagatgcatctggt
aacaaacttcttaaagatgttggcctttggctgtcacaaagcatcaaggatcattttaat
cagaagaagatggtgatgaacctcaagtacatagatccaacatacatgattcgagctgtt
cctagcaatgcgtcagacaatgtttattgtacacttctggctcagagtgcagtgcacggt
gcaatggctggatacactggctatatcagtggtctagtgaacggaagacaaacctacata
cccttttacaggataacggagaaacagaaccatgtggtgatcacagacaggatgtgggca
aggctactctcttcgacaaaccagccgagtttcttgggccccaaagatgtctttgataat
aaagagaaaccgatgtcggctctccttgacgatggtaactgcaatggcgtggtggatgtt
cctccagtcaccaaagagatcaccaagtga

DBGET integrated database retrieval system