KEGG   Arabidopsis thaliana (thale cress): AT4G26530Help
Entry
AT4G26530         CDS       T00041                                 

Definition
(RefSeq) fructose-bisphosphate aldolase 5
  KO
K01623  
fructose-bisphosphate aldolase, class I [EC:4.1.2.13]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Gluconeogenesis, oxaloacetate => fructose-6P
Reductive pentose phosphate cycle (Calvin cycle)
Reductive pentose phosphate cycle, glyceraldehyde-3P => ribulose-5P
Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:ath00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    AT4G26530
   01230 Biosynthesis of amino acids
    AT4G26530
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AT4G26530
   00030 Pentose phosphate pathway
    AT4G26530
   00051 Fructose and mannose metabolism
    AT4G26530
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    AT4G26530
Enzymes [BR:ath01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     AT4G26530
Chromosome [BR:ath03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    AT4G26530
Exosome [BR:ath04147]
 Exosomal proteins
  Proteins found in most exosomes
   AT4G26530
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
4
AA seq 358 aa AA seqDB search
MSAFVGKYADELIKTAKYIATPGKGILAADESTGTIGKRFASINVENIESNRQALRELLF
TSPGTFPCLSGVILFEETLYQKTTDGKPFVELLMENGVIPGIKVDKGVVDLAGTNGETTT
QGLDSLGARCQEYYKAGARFAKWRAVLKIGATEPSELSIQENAKGLARYAIICQENGLVP
IVEPEVLTDGSHDIKKCAAVTETVLAAVYKALNDHHVLLEGTLLKPNMVTPGSDSPKVAP
EVIAEYTVTALRRTVPPAVPGIVFLSGGQSEEEATLNLNAMNKLDVLKPWTLTFSFGRAL
QQSTLKAWAGKTENVAKAQATFLTRCKGNSDATLGKYTGGASGDSAASESLYEEGYKY
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
atgtctgcttttgtcggcaaatacgcagatgagctgataaagacggctaagtacattgcc
acaccgggaaagggcattttggcagcagacgagagcacgggaactattgggaaacgattc
gccagcatcaatgttgagaacattgagtccaaccgccaagctctccgtgagctcctcttc
acgtcccctggcactttcccttgcctctccggtgttatcctcttcgaggaaaccctctac
cagaaaaccacggatggcaaacccttcgttgagctcctcatggaaaacggagttatccct
ggaatcaaagtggacaagggtgtggttgatctagcaggaaccaatggcgagaccactact
cagggtctagattcacttggtgcacgttgccaggagtattacaaggcaggagctcggttt
gcaaaatggcgtgcagtcctcaagattggggccaccgagccaagcgagctctctatccaa
gagaacgccaaggggctagcccgctatgccatcatctgccaggagaatggactcgtccca
atcgtcgagccagaggtactgaccgacgggagccatgacatcaagaaatgtgcagcggtg
accgagaccgttcttgctgccgtgtacaaggccttgaacgaccaccatgtcctcctcgaa
ggcactctgcttaaaccgaacatggtcactcccggctctgacagcccaaaggttgcaccg
gaagtgatagcggaatacacagtgactgctctgcgccgcacagtcccacctgcagttcca
ggaatcgtgttcctctcaggcggacagagtgaagaggaagcaacactaaatctgaacgca
atgaacaagctcgatgtgttgaagccatggactctcactttctcatttggccgagccctc
caacaaagcactctcaaggcttgggcaggtaagacagagaatgtagccaaagctcaggcc
actttcctgaccaggtgcaagggtaactcggacgctaccctcgggaaatacaccggcggg
gcttctggtgactcggccgcctctgagagcttgtatgaggaaggatacaagtattag

DBGET integrated database retrieval system