KEGG   Arabidopsis thaliana (thale cress): AT4G26610Help
Entry
AT4G26610         CDS       T00041                                 

Gene name
D6PKL1
Definition
(RefSeq) D6 protein kinase like 1
Organism
ath  Arabidopsis thaliana (thale cress)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
4
AA seq 506 aa AA seqDB search
MASKYGSGVLPENKKEKGDKETPETSYSSQSVSVNTLADQVSSTLSFAPSSDSKTGGEVK
FNEKSDQSGKSNTCRPSTSSDISDESTCSSFSGNNKPHKANDVRWEAIQAVRTKHGVLGL
NHFRLLKRLGCGDIGTVHLAELHGTRCFFAMKVMDKGALASRKKLLRAQTEREILQCLDH
PFLPTLYSHFETEKFSCLVMEFCPGGDLHTLRQRQPGKRFSEQAAKFYVAEVLLAMEYLH
MLGIIYRDLKPENVLVRDDGHVMLSDFDLSLRCTVSPTVVRSTVLASEGQKNSGYCAQPA
CIQQPSCISAPTTCFSPRYFSSKSKKDKKMKNETGNQVSPLPELVAEPTSARSMSFVGTH
EYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNVVGQPLRFPESPV
VSFAARDLIRSLLVKEPQHRLAYKRGATEMKQHPFFEGVNWALVRCASPPEIPKPVDYES
APATPAAATSTSVKSDQSNYLEFDFF
NT seq 1521 nt NT seq  +upstreamnt  +downstreamnt
atggcctcgaagtatggttctggagttctcccagaaaataagaaggaaaagggcgataag
gaaaccccggaaacatcttattccagtcaaagtgtctcagtaaacactttggcagatcaa
gtatcttcaactttgtcttttgctccaagcagcgacagtaaaactggaggtgaagttaaa
tttaatgaaaagtctgatcagagcgggaagagtaacacatgtagaccaagcacaagcagt
gatatcagtgatgagagcacatgtagcagctttagtggtaacaacaagcctcacaaggcg
aatgacgtgagatgggaagcaattcaagctgtccgaacgaaacatggcgtattggggttg
aaccattttaggctcttgaagaggttagggtgtggggatatcggaactgtccaccttgct
gagttgcacggaacaaggtgtttttttgcaatgaaggttatggacaaaggggctttggct
agccgtaaaaagcttcttagagctcagaccgagagggagatattgcagtgtcttgaccac
ccttttctcccaactttgtatagtcacttcgagactgagaagttctcatgtttggttatg
gagttctgtcctggaggtgacttgcatacccttcgacaaagacagcccgggaagcgattt
tcagaacaagcagcaaagttttatgtagcggaagtacttcttgcaatggaatatcttcat
atgcttggcatcatataccgcgatctaaagccagagaatgttcttgttagagatgatgga
catgtgatgctttctgacttcgacctctccttgagatgtactgttagccccacagtggtc
agatcaactgttcttgcgtctgaagggcaaaagaactcgggttattgtgcgcaacctgct
tgcatccaacagccatcttgcatttctgctcctacaacatgcttttctccacgttatttc
tcaagtaaatccaagaaagacaagaaaatgaaaaacgaaactggaaaccaggtaagtcca
ttgcccgagctcgttgctgagcccacaagtgctcgctcaatgtcatttgttggcacacat
gagtatttagctcctgagatcatcaaaggtgaagggcatgggagtgcggttgattggtgg
acttttgggatctttttgtatgagctattgtttggtaaaaccccgtttaaagggtcagga
aaccgagcaacactcttcaacgttgtgggtcagcctctgcgtttcccagaatctccagtt
gtcagttttgctgctagggatttgattaggagtctgcttgtgaaagagcctcagcataga
ttagcgtataagcgtggtgcaactgagatgaagcaacatcctttctttgaaggagtgaat
tgggcattggttcgatgcgctagcccaccagagataccaaaaccggttgattatgagagt
gcgcctgctactccagcagcagccacatctactagtgtcaagtctgaccagagtaattat
ctggagttcgatttcttttga

DBGET integrated database retrieval system