KEGG   Arabidopsis thaliana (thale cress): AT4G26910Help
Entry
AT4G26910         CDS       T00041                                 

Definition
Dihydrolipoamide succinyltransferase
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ath00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    AT4G26910
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    AT4G26910
  Amino acid metabolism
   00310 Lysine degradation
    AT4G26910
Enzymes [BR:ath01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     AT4G26910
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
4
AA seq 464 aa AA seqDB search
MMMRAVIRRAASNGSSPSLFAKSLQSSRVAASSPSLLSGSETGAYLHRGNHAHSFHNLAL
PAGNSGISRSASLVSSTLQRWVRPFSAETGDTVEAVVPHMGESITDGTLATFLKKPGERV
QADEAIAQIETDKVTIDIASPASGVIQEFLVNEGDTVEPGTKVAIISKSEDTASQVTPSQ
KIPETTDTKPSPPAEDKQKPRVESAPVAEKPKAPSSPPPPKQSAKEPQLPPKERERRVPM
TRLRKRVATRLKDSQNTFALLTTFNEVDMTNLMKLRSQYKDAFYEKHGVKLGLMSGFIKA
AVSALQHQPVVNAVIDGDDIIYRDYVDISIAVGTSKGLVVPVIRGADKMNFAEIEKTINS
LAKKANEGTISIDEMAGGSFTVSNGGVYGSLISTPIINPPQSAILGMHSIVSRPMVVGGS
VVPRPMMYVALTYDHRLIDGREAVYFLRRVKDVVEDPQRLLLDI
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
atgatgatgcgtgctgttataaggagagctgccagtaatggctcttctccttcgttattc
gcaaaatcactgcagtcttctcgtgttgctgcatcttcccctagcttgctatcaggttca
gaaacaggggcatatctgcatcgtggaaatcatgctcatagctttcataaccttgctttg
ccagcagggaactcgggcatctcgaggtcggcgagtttagtttcttcaaccctgcaaaga
tgggtcaggcctttttcagctgaaactggagataccgtggaagcagttgtgcctcatatg
ggggaatcaattactgatggcaccttggccacctttctgaagaaacctggtgagagagtc
caggctgatgaggctattgcacaaattgaaactgataaggtgacaatagatattgctagc
ccagcaagtggtgtaatccaagagtttctagtcaacgaaggagatactgtagaaccagga
accaaggtcgctattatatcaaagtctgaggatactgcatctcaggttaccccctctcag
aagataccagagacaactgataccaaaccttctcctcctgctgaagataagcagaagccc
agagtggaaagtgctcctgtagcagagaaacccaaagcaccatcctcaccacctccaccc
aaacagtctgctaaagaaccgcagcttcctcctaaggaaagagaaagacgggttccgatg
acaagacttcggaaacgagttgcaacaagattgaaagactctcaaaatactttcgcgttg
ctgacaactttcaatgaagttgatatgacaaatttgatgaagctccgatcccaatacaag
gatgcattttatgaaaagcatggagtgaagttggggcttatgtctggatttattaaagct
gctgttagcgcccttcagcatcaaccagttgtaaatgcagttattgacggggatgatatc
atatacagagactatgtggatatcagtatcgctgttggtacctctaagggacttgtagta
ccagtcataagaggtgctgataaaatgaactttgccgagatagagaagacgataaactca
cttgccaagaaggcaaatgaaggaaccatatccatagatgagatggctggcggatcattc
accgtttcaaatggcggtgtctatggaagtctcataagcactccgatcattaatcctcct
cagtctgccatactcggcatgcactcgattgtgtcacgtccaatggtagtaggaggaagc
gtagtgcctagaccaatgatgtatgtcgcacttacgtatgatcacaggctgattgatggt
agagaggctgtgtacttcctgcgccgtgtcaaggatgttgtggaggatccacaaaggctt
cttcttgacatataa

DBGET integrated database retrieval system