KEGG   Arabidopsis thaliana (thale cress): AT4G27070Help
Entry
AT4G27070         CDS       T00041                                 

Gene name
TSB2
Definition
tryptophan synthase beta chain
Orthology
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:ath00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    AT4G27070 (TSB2)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    AT4G27070 (TSB2)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    AT4G27070 (TSB2)
Enzymes [BR:ath01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     AT4G27070 (TSB2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
4
AA seq 475 aa AA seqDB search
MATASTAATFRPSSVSASSELTHLRSPSKLPKFTPLPSARSRSSSSFSVSCTIAKDPAVV
MADSEKIKAAGSDPTMWQRPDSFGRFGKFGGKYVPETLMHALSELETAFYSLATDEDFQR
ELAEILKDYVGRESPLYFAERLTEHYRRENGEGPLIYLKREDLNHTGAHKINNAVAQALL
AKRLGKKRIIAETGAGQHGVATATVCARFGLQCIIYMGAQDMERQALNVFRMRLLGAEVR
GVHSGTATLKDATSEAIRDWVTNVETTHYILGSVAGPHPYPMMVRDFHAVIGKETRKQAM
EKWGGKPDVLVACVGGGSNAMGLFHEFVDDTEVRMIGVEAAGFGLDSGKHAATLTKGDVG
VLHGAMSYLLQDDDGQIIEPHSISAGLDYPGVGPEHSFLKDVGRAEYFSVTDEEALEAFK
RVSRLEGIIPALETSHALAHLEKLCPTLPDGARVVLNFSGRGDKDVQTAIKYLEV
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
atggccaccgcaagcaccgctgctactttcagaccctcctccgtttcagcttcttccgaa
ttaacccatctgagatcaccctccaaactccccaaatttacgcctctgccatcggctcgc
tcacggtcctcttcttcgttctccgtctcctgcaccatcgctaaggacccagctgttgtc
atggcggactcggagaagattaaggccgctggatctgatccgactatgtggcaacgacct
gattcattcggtcgtttcgggaagtttggcggcaagtacgtccccgaaactctaatgcac
gccctctctgaactcgaaacggctttctattcgctcgccaccgacgaagatttccagaga
gaattagcagagatcttgaaagactacgttggtcgggaaagtcctctttactttgcagag
aggctcacggagcattaccgccgtgaaaacggtgaagggccgctcatatacctcaaaagg
gaagacttgaaccacaccggtgctcacaagatcaacaacgctgtggctcaggctcttctc
gccaagcgtctaggaaagaaacgaattattgctgagacaggggctggtcaacatggtgta
gccacagctactgtgtgtgcacgtttcggtttgcagtgcattatctacatgggtgctcaa
gacatggagagacaagctcttaatgtgttcagaatgcgtcttctcggtgctgaggtaagg
ggagtccactctggaacagccactttaaaggacgcaacttctgaagctataagggattgg
gtgaccaatgtggagactacacattacatattgggatccgttgcgggtcctcatccttat
cctatgatggtcagagactttcacgcggtgattggtaaagaaacaaggaaacaagcgatg
gagaaatggggcgggaagcctgatgttctggttgcttgtgtcggtggtggttcaaatgct
atgggactcttccatgaatttgtcgatgacacagaggttcgaatgattggtgtggaagcc
gctggatttggattggacagcggcaaacatgctgccacattgacaaaaggagatgtcggt
gtactccacggagctatgagttacttgctgcaagatgatgatggccaaatcattgaacca
cactccatcagtgccggattggactaccctggagtcggacctgagcatagtttccttaaa
gacgtgggaagggctgaatactttagcgttactgatgaagaagcattagaagctttcaag
agagtgtctcggttggagggaataatcccggcattggagacatcgcacgcattggcccat
ctggagaagctttgtccgacgttacctgatggagccagagtggtattaaacttcagtggg
agaggcgacaaggatgttcagactgcaatcaagtatctcgaagtttaa

DBGET integrated database retrieval system