KEGG   Arabidopsis thaliana (thale cress): AT4G27130Help
Entry
AT4G27130         CDS       T00041                                 

Definition
(RefSeq) Translation initiation factor SUI1 family protein
  KO
K03113  translation initiation factor 1
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath03013  RNA transport
Brite
KEGG Orthology (KO) [BR:ath00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    AT4G27130
Translation factors [BR:ath03012]
 Eukaryotic Type
  Initiation factors
   eIF-1
    AT4G27130
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SUI1 Ocnus
Motif
Other DBs
NCBI-GeneID: 828821
NCBI-ProteinID: NP_194443
MIPS: AT4G27130.1
TAIR: AT4G27130
Araport: AT4G27130
UniProt: P41568 A0A178V093
Position
4
AA seq 113 aa AA seqDB search
MSELDSQVPTAFDPFADANAEDSGAGTKEYVHIRVQQRNGRKSLTTVQGLKKEYSYTKIL
KDLKKEFCCNGTVVQDSELGQVIQLQGDQRKNVSTFLVQAGLVKKDNIKIHGF
NT seq 342 nt NT seq  +upstreamnt  +downstreamnt
atgtctgaacttgattcccaggtccctactgccttcgacccgtttgctgatgcgaatgct
gaggactcaggtgcaggaacaaaggagtacgttcatattcgtgtccagcagcggaatggt
aggaaaagcttgacaacggtccaggggctgaagaaagagtacagctacaccaagatactt
aaggacctcaagaaagaattttgctgcaacggaactgtggttcaagactcagaactcgga
caggttattcagcttcaaggcgatcagaggaagaacgtctccacgttcctagtccaggct
gggcttgtgaagaaagataacatcaagatccatggtttctga

DBGET integrated database retrieval system