KEGG   Arabidopsis thaliana (thale cress): AT4G27130Help
Entry
AT4G27130         CDS       T00041                                 

Definition
(RefSeq) protein translation factor SUI1-1
  KO
K03113  
translation initiation factor 1
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:ath00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    AT4G27130
Translation factors [BR:ath03012]
 Eukaryotic Type
  Initiation factors
   eIF-1
    AT4G27130
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
4
AA seq 113 aa AA seqDB search
MSELDSQVPTAFDPFADANAEDSGAGTKEYVHIRVQQRNGRKSLTTVQGLKKEYSYTKIL
KDLKKEFCCNGTVVQDSELGQVIQLQGDQRKNVSTFLVQAGLVKKDNIKIHGF
NT seq 342 nt NT seq  +upstreamnt  +downstreamnt
atgtctgaacttgattcccaggtccctactgccttcgacccgtttgctgatgcgaatgct
gaggactcaggtgcaggaacaaaggagtacgttcatattcgtgtccagcagcggaatggt
aggaaaagcttgacaacggtccaggggctgaagaaagagtacagctacaccaagatactt
aaggacctcaagaaagaattttgctgcaacggaactgtggttcaagactcagaactcgga
caggttattcagcttcaaggcgatcagaggaagaacgtctccacgttcctagtccaggct
gggcttgtgaagaaagataacatcaagatccatggtttctga

DBGET integrated database retrieval system