KEGG   Arabidopsis thaliana (thale cress): AT4G27820Help
Entry
AT4G27820         CDS       T00041                                 

Gene name
BGLU9
Definition
(RefSeq) beta glucosidase 9
Organism
ath  Arabidopsis thaliana (thale cress)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
4
AA seq 506 aa AA seqDB search
MKHFSLLFIFLVILLATSYSDAFTRNSFPKDFLFGAATSAYQWEGAVAEDGRTPSVWDTF
SNSYDTGNGDVTSDGYHKYKEDVKLMATMGLESFRFSISWSRLIPNGRGLINPKGLLFYN
NLIKDLKSHGIEPHVTLYHYDLPQSLEDEYGGWINRKIIEDFTAYADVCFREFGEDVKLW
TTINEATIFAIGSYDQGTAPPGHCSPNKFVNCSTGNSSTEPYIAGHNILLAHASASKLYK
LKYKSKQKGSIGLSIFAFGLSPYTNSKDDEIATQRAKTFLYGWMLKPLVFGDYPDEMKKT
VGSRLPVFSEEESEQVKGSSDFIGIIHYTTFYVTNHQPSASLFPSMGEGFFKDMGVYIIP
TGNSSFLVWEATPWGLEGILEYIKQSYNNPPVYILENGMPMVRDSTLQDTQRIEYIQAYI
DAVLNAMKNGSDTRGYFVWSMVDVYEILSGYTTSFGMYHVNFSDPGRKRTPKLSASWYTG
FLNGTIDVASQDTIQLWSNFSVSSSL
NT seq 1521 nt NT seq  +upstreamnt  +downstreamnt
atgaaacatttctctctacttttcatttttctggtcatcctcttggcaacaagctacagt
gatgcctttaccagaaacagttttccaaaggatttcctcttcggagccgccacttctgct
tatcagtgggaaggagctgttgctgaagatggaagaactcctagtgtctgggatactttc
tccaactcttacgatacaggtaatggagatgtaacatctgatgggtatcacaaatacaag
gaagatgttaagctgatggcaacaatgggcttagaatcattcagattctctatctcctgg
tcaagacttatacctaatggaagaggactcattaatccaaaaggactattgttttacaac
aatctcatcaaagacctaaaaagccatggaatcgaaccacatgttacactttaccactat
gatcttcctcagtctcttgaagatgagtacggcggatggatcaaccgcaaaatcatagaa
gacttcactgcttatgcagatgtatgcttcagagagtttggggaggatgtgaagttatgg
actacaataaacgaagctacaattttcgccattggttcttatgaccaaggaaccgcgccg
cctggacattgttctcctaataaattcgtcaattgttctactggaaattcttctacagaa
ccatatattgcaggccataacatattgctagctcatgcctctgcttcaaagttgtataaa
ctaaagtacaagagtaagcagaaaggatccatagggcttagtatatttgcattcgggtta
tctccatatacaaactccaaggatgatgaaatcgcaactcaaagagctaaaactttctta
tatggctggatgttgaagcctttggtatttggagactatccggatgaaatgaagaaaact
gtgggatcgagattaccagttttctcagaggaagagtcagagcaagttaaaggatcatct
gactttataggaattattcattacacaacattctatgtcacaaaccaccaaccttcagct
tctctctttcccagcatgggtgaaggcttctttaaagacatgggagtatatataattccc
actgggaattcttcatttcttgtgtgggaggctactccatggggtcttgaaggtattctt
gagtatataaagcagagctataacaatcctccagtctatattcttgaaaatggtatgccg
atggtacgcgattcgacactacaagacacacaaagaattgaatacattcaagcttacatt
gacgctgtactcaacgcaatgaagaatggatcggacacgagaggttactttgtatggtcg
atggttgatgtgtatgagatattgagtggatatacgaccagcttcggaatgtaccatgtg
aatttcagcgatcctggtcgcaagaggactccaaagctctctgcttcttggtacactggt
ttccttaatggtacaattgatgttgcttctcaagatactattcagttgtggagcaacttc
tctgtctcttcttcattgtaa

DBGET integrated database retrieval system