KEGG   Arabidopsis thaliana (thale cress): AT4G27960Help
Entry
AT4G27960         CDS       T00041                                 

Gene name
UBC9
Definition
(RefSeq) ubiquitin conjugating enzyme 9
Organism
ath  Arabidopsis thaliana (thale cress)
SSDB OrthologParalogGFIT
Motif
Pfam: UQ_con RWD Prok-E2_B UEV G-gamma
Motif
Other DBs
NCBI-GeneID: 828909
NCBI-ProteinID: NP_849462
MIPS: AT4G27960.1
TAIR: AT4G27960
Araport: AT4G27960
UniProt: P35132 A0A178UV17
Position
4
AA seq 148 aa AA seqDB search
MASKRILKELKDLQKDPPTSCSAGPVAEDMFHWQATIMGPSDSPYSGGVFLVTIHFPPDY
PFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLV
PEIAHMYKTDKNKYESTARTWTQKYAMG
NT seq 447 nt NT seq  +upstreamnt  +downstreamnt
atggcatcgaaacggattttgaaggaattgaaggatctgcagaaggatcctcctacttca
tgtagcgcaggacccgttgcggaagacatgtttcattggcaggccactataatgggtcca
tcggatagcccttattctggaggagtttttcttgtaaccatccatttccctccagattac
ccatttaagcctcctaaggtggcttttaggacgaaggtgttccatccaaacattaacagc
aatggaagcatctgcctcgacatcttgaaggagcagtggagtcctgctctcacaatttcc
aaggtgctgctatcgatctgttctttgttaacggatccaaacccagatgatcctttggtc
cctgagatagctcacatgtacaagacagacaagaacaagtacgagtccactgctcggacc
tggacccaaaagtatgccatgggctga

DBGET integrated database retrieval system