KEGG   Arabidopsis thaliana (thale cress): AT4G29010Help
Entry
AT4G29010         CDS       T00041                                 

Gene name
AIM1
Definition
fatty acid beta-oxidation multifunctional protein AIM1
Orthology
K10527  
enoyl-CoA hydratase/3-hydroxyacyl-CoA dehydrogenase [EC:4.2.1.17 1.1.1.35 1.1.1.211]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
Fatty acid degradation
alpha-Linolenic acid metabolism
Metabolic pathways
Fatty acid metabolism
Module
beta-Oxidation
Jasmonic acid biosynthesis
Brite
KEGG Orthology (KO) [BR:ath00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    AT4G29010 (AIM1)
  Lipid metabolism
   00071 Fatty acid degradation
    AT4G29010 (AIM1)
   00592 alpha-Linolenic acid metabolism
    AT4G29010 (AIM1)
Enzymes [BR:ath01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     AT4G29010 (AIM1)
    1.1.1.211  long-chain-3-hydroxyacyl-CoA dehydrogenase
     AT4G29010 (AIM1)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     AT4G29010 (AIM1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
4
AA seq 721 aa AA seqDB search
MAKKIGVTMEVGNDGVAVITISNPPVNSLASPIISGLKEKFRDANQRNDVKAIVLIGNNG
RFSGGFDINVFQQVHKTGDLSLMPEVSVELVCNLMEDSRKPVVAAVEGLALGGGLELAMA
CHARVAAPKAQLGLPELTLGVIPGFGGTQRLPRLVGLAKATDMILLSKSISSEEGHKLGL
IDALVPPGDVLSTSRKWALDIAEGRKPFLQSLHRTDKIGSLSEARAILKNSRQLAKKIAP
NMPQHHACIEVIEEGIIHGGYSGVLKEAEVFKQLVLSDTAKGLVHVFFAQRATSKVPNVT
DVGLKPRPIKKVAVIGGGLMGSGIATALLLSNIRVVLKEINSEFLMKGIKSVEANMKSLV
SRGKLTQDKAGKALSLFKGVLDYTEFNDVDMVIEAVIENIQLKQNIFKEIEKVCSPHCIL
ASNTSTIDLDVIGEKTNSKDRIVGAHFFSPAHLMPLLEIVRSKNTSAQVILDLMAVGKAI
KKVPVVVGNCIGFAVNRTFFPYSQAAHMLANLGVDLFRIDSVITSFGLPLGPFQLGDLAG
HGIGLAVGPIYAKVYGDRMFRSPMTELLLKSGRNGKINGRGYYIYEKGSKPKPDPSVLSI
VEKSRKLTNIMPGGKPISVTDKEIVEMILFPVVNEACRVLDEGVVIRASDLDIASVLGMS
FPSYRGGIVFWADTVGPKYIYERLKKLSETYGSFFKPSRYLEERAMNGMLLSESKSSRSK
L
NT seq 2166 nt NT seq  +upstreamnt  +downstreamnt
atggcgaagaagattggagtaacgatggaagttgggaacgatggtgttgctgtcatcacc
atttctaaccctcctgttaactctttagccagtccaattatttctgggttgaaggagaag
tttcgtgacgccaatcaaaggaatgatgttaaggccatcgtgttgatcgggaacaatgga
agattttcgggtggttttgatatcaatgtctttcagcaagttcataagactggggattta
tcgcttatgcctgaagtatctgttgagcttgtgtgtaacctgatggaagactccaggaag
ccggttgttgctgcagttgaaggattagctcttggtggtggtttggaacttgcaatggcg
tgtcatgccagagttgctgctccgaaagctcaattaggcttaccagaactgactcttgga
gtgattcctggttttggaggaacccaacgtcttccaaggttagtaggccttgcaaaagca
acggatatgatactgctttctaagtcaatatcctcagaagaggggcacaaactgggtctc
attgatgccttggtgccacctggagatgtgttgagcacatccagaaagtgggctctagac
attgcagagggacgtaaaccctttctgcagtcactgcacagaaccgacaaaattggttct
ttatctgaagctcgtgctatattgaagaattcaagacagctagccaagaagattgcccca
aatatgcctcagcaccatgcttgcattgaggtgattgaagaaggaatcatccatggagga
tacagtggggttctcaaggaagcagaagttttcaagcaactagtactgtcagacactgca
aagggtcttgttcatgttttctttgcacaacgtgcaacatcaaaagtgcctaatgtaact
gacgttggattgaaaccaaggccgataaaaaaagttgcagttattggtggcggtctgatg
ggttcaggcatcgctacggctctacttctaagcaatataagagttgtgctcaaagaaata
aactcagaattccttatgaagggaataaaatcagttgaagcaaatatgaaaagcttggta
tctagggggaaactgacacaagataaagcaggaaaggccctctctttgttcaagggagta
cttgattacacagaattcaatgatgtggacatggtcatagaggcagtgattgaaaacatt
caattgaaacaaaacatattcaaagaaatcgaaaaggtttgttcaccccactgcattttg
gcgagtaatacatctactatcgacctcgatgtaattggtgaaaagactaactcaaaagat
cgcattgttggcgcacatttcttcagtccggcccatctgatgccccttctcgagattgtt
cgttcaaagaatacttctgctcaggtgattctggatctcatggcggttggaaaggccata
aagaaagttcccgtggtggttggaaactgcataggctttgcagtgaataggacattcttt
ccttattcacaagctgcacatatgttggccaatctaggtgttgacttgttcagaattgac
agcgttattacctctttcggcttgccattgggccctttccagcttggtgatttggctgga
cacgggattggattagcagttgggccgatatatgccaaggtctatggtgaccgcatgttc
agatctccaatgacagagcttcttcttaagagcgggcgaaatggaaaaatcaacggaaga
ggatactatatatacgaaaagggaagcaaaccaaaacctgatccatcagtgctttcaatt
gttgagaaatcaaggaaactgaccaatatcatgcctggtgggaagcctatatcagtaact
gataaagaaattgtagagatgatcttattccctgttgtcaacgaggcatgccgcgtccta
gatgaaggagttgtgatccgagcctcagacttggacattgcgtctgtccttggaatgagt
tttccttcttaccggggaggaattgttttctgggcagacactgttggaccaaagtacata
tatgagaggctcaagaaattgtcggagacttatggcagctttttcaaaccatcgaggtat
ctggaggaaagagcaatgaatggaatgcttttgagtgaatcgaaatcgtcgaggtccaaa
ttgtga

DBGET integrated database retrieval system