KEGG   Arabidopsis thaliana (thale cress): AT4G29350Help
Entry
AT4G29350         CDS       T00041                                 

Gene name
PFN2
Definition
(RefSeq) profilin 2
  KO
K05759  
profilin
Organism
ath  Arabidopsis thaliana (thale cress)
Brite
Membrane trafficking [BR:ath04131]
 Others
  Actin-binding proteins
   Others
    AT4G29350 (PFN2)
Cytoskeleton proteins [BR:ath04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Profilin
     AT4G29350 (PFN2)
Exosome [BR:ath04147]
 Exosomal proteins
  Proteins found in most exosomes
   AT4G29350 (PFN2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
4
AA seq 131 aa AA seqDB search
MSWQSYVDDHLMCEVEGNHLTHAAIFGQDGSVWAQSSAFPQLKPAEIAGINKDFEEAGHL
APTGLFLGGEKYMVVQGEAGAVIRGKKGPGGVTIKKTTQALVFGIYDEPMTGGQCNLVVE
RLGDYLIESGL
NT seq 396 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtggcaatcatacgtcgatgaccatctcatgtgcgaggtcgaaggcaaccacctc
acacacgccgccatcttcggccaagacggcagtgtctgggctcagagctcagctttccct
cagttgaagcctgcagagatagcaggaatcaacaaagactttgaagaagccggacatctt
gccccaaccgggctattccttggcggtgagaagtacatggttgtccaaggtgaggctgga
gccgtcatccgagggaaaaagggacctggtggagtcactatcaagaagactactcaagct
ctagtctttggtatctatgatgaaccgatgaccggagggcaatgcaacttggtcgtggag
aggctcggcgattaccttatcgagtctggtctctaa

DBGET integrated database retrieval system