KEGG   Arabidopsis thaliana (thale cress): AT4G29350Help
Entry
AT4G29350         CDS       T00041                                 

Gene name
PFN2
Definition
profilin 2
Orthology
K05759  
profilin
Organism
ath  Arabidopsis thaliana (thale cress)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
4
AA seq 131 aa AA seqDB search
MSWQSYVDDHLMCEVEGNHLTHAAIFGQDGSVWAQSSAFPQLKPAEIAGINKDFEEAGHL
APTGLFLGGEKYMVVQGEAGAVIRGKKGPGGVTIKKTTQALVFGIYDEPMTGGQCNLVVE
RLGDYLIESGL
NT seq 396 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtggcaatcatacgtcgatgaccatctcatgtgcgaggtcgaaggcaaccacctc
acacacgccgccatcttcggccaagacggcagtgtctgggctcagagctcagctttccct
cagttgaagcctgcagagatagcaggaatcaacaaagactttgaagaagccggacatctt
gccccaaccgggctattccttggcggtgagaagtacatggttgtccaaggtgaggctgga
gccgtcatccgagggaaaaagggacctggtggagtcactatcaagaagactactcaagct
ctagtctttggtatctatgatgaaccgatgaccggagggcaatgcaacttggtcgtggag
aggctcggcgattaccttatcgagtctggtctctaa

DBGET integrated database retrieval system