KEGG   Arabidopsis thaliana (thale cress): AT4G29810Help
Entry
AT4G29810         CDS       T00041                                 

Gene name
MKK2
Definition
(RefSeq) mitogen-activated protein kinase kinase 2
  KO
K20603  
mitogen-activated protein kinase kinase 2 [EC:2.7.12.2]
Organism
ath  Arabidopsis thaliana (thale cress)
Brite
KEGG Orthology (KO) [BR:ath00001]
 Environmental Information Processing
  Signal transduction
   04016 MAPK signaling pathway - plant
    AT4G29810 (MKK2)
Enzymes [BR:ath01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     AT4G29810 (MKK2)
Protein kinases [BR:ath01001]
 Serine/threonine protein kinases: STE group
  STE7 family
   AT4G29810 (MKK2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
4
AA seq 363 aa AA seqDB search
MKKGGFSNNLKLAIPVAGEQSITKFLTQSGTFKDGDLRVNKDGVRIISQLEPEVLSPIKP
ADDQLSLSDLDMVKVIGKGSSGVVQLVQHKWTGQFFALKVIQLNIDEAIRKAIAQELKIN
QSSQCPNLVTSYQSFYDNGAISLILEYMDGGSLADFLKSVKAIPDSYLSAIFRQVLQGLI
YLHHDRHIIHRDLKPSNLLINHRGEVKITDFGVSTVMTNTAGLANTFVGTYNYMSPERIV
GNKYGNKSDIWSLGLVVLECATGKFPYAPPNQEETWTSVFELMEAIVDQPPPALPSGNFS
PELSSFISTCLQKDPNSRSSAKELMEHPFLNKYDYSGINLASYFTDAGSPLATLGNLSGT
FSV
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaaggtggattcagcaataatctcaagctcgcaattcctgttgctggcgagcaa
tccatcaccaaattcctgactcaaagcggtacgtttaaggatggagatctacgtgttaac
aaggatggagttcgaatcatttctcaattggagcctgaagtcctgtctccaattaagcca
gctgatgatcagctgagcttgtcggatttggatatggttaaagtcattggcaaaggaagt
agtggtgttgttcagctggttcaacacaaatggactggccaatttttcgccttgaaggtc
attcaactaaatattgatgaagcaattcgcaaggcaattgcacaagagctcaaaataaat
caatcgtcacagtgtccaaatcttgttacctcgtaccagtcattttatgacaatggcgca
atctcactaatcttggagtacatggacggaggatctctagcagactttctcaagtcagtt
aaagccatccctgactcctatctttctgccatctttagacaagtgcttcaaggattaatc
tatcttcatcacgataggcatatcatccatcgtgacttgaaaccatccaatctgttgatc
aaccacagaggagaagtcaaaataactgactttggtgtgagtaccgttatgacaaacacc
gcaggtttagcaaacacatttgtggggacttacaattatatgtctccagagagaatcgtt
ggaaacaagtacggaaataaaagtgatatatggagcttgggtttagtagtactcgaatgt
gcaacaggaaagttcccttatgcacctccgaatcaagaggaaacatggaccagtgttttc
gagttgatggaagccattgttgaccaaccgccacccgctcttccttcaggaaatttctcc
cctgagttatcttcattcatctccacatgtttgcagaaggatccaaacagtcgaagctct
gcaaaggaactgatggaacatcctttcttgaacaaatacgactactcggggatcaatctc
gcgtcctacttcacagatgcaggatcgccacttgcaacacttgggaacctgtctggtacg
ttctccgtgtaa

DBGET integrated database retrieval system