KEGG   Arabidopsis thaliana (thale cress): AT4G29810Help
Entry
AT4G29810         CDS       T00041                                 

Gene name
MKK2
Definition
mitogen-activated protein kinase kinase 2
Orthology
K04368  
mitogen-activated protein kinase kinase 1 [EC:2.7.12.2]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
Plant-pathogen interaction
Class
Organismal Systems; Environmental adaptation; Plant-pathogen interaction [PATH:ath04626]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
4
AA seq 372 aa AA seqDB search
MKKGGFSNNLKLAIPVAGEQSITKFLRKGFGSLCRTQSGTFKDGDLRVNKDGVRIISQLE
PEVLSPIKPADDQLSLSDLDMVKVIGKGSSGVVQLVQHKWTGQFFALKVIQLNIDEAIRK
AIAQELKINQSSQCPNLVTSYQSFYDNGAISLILEYMDGGSLADFLKSVKAIPDSYLSAI
FRQVLQGLIYLHHDRHIIHRDLKPSNLLINHRGEVKITDFGVSTVMTNTAGLANTFVGTY
NYMSPERIVGNKYGNKSDIWSLGLVVLECATGKFPYAPPNQEETWTSVFELMEAIVDQPP
PALPSGNFSPELSSFISTCLQKDPNSRSSAKELMEHPFLNKYDYSGINLASYFTDAGSPL
ATLGNLSGTFSV
NT seq 1119 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaaggtggattcagcaataatctcaagctcgcaattcctgttgctggcgagcaa
tccatcaccaaattcctgaggaaaggttttggttctctctgtaggactcaaagcggtacg
tttaaggatggagatctacgtgttaacaaggatggagttcgaatcatttctcaattggag
cctgaagtcctgtctccaattaagccagctgatgatcagctgagcttgtcggatttggat
atggttaaagtcattggcaaaggaagtagtggtgttgttcagctggttcaacacaaatgg
actggccaatttttcgccttgaaggtcattcaactaaatattgatgaagcaattcgcaag
gcaattgcacaagagctcaaaataaatcaatcgtcacagtgtccaaatcttgttacctcg
taccagtcattttatgacaatggcgcaatctcactaatcttggagtacatggacggagga
tctctagcagactttctcaagtcagttaaagccatccctgactcctatctttctgccatc
tttagacaagtgcttcaaggattaatctatcttcatcacgataggcatatcatccatcgt
gacttgaaaccatccaatctgttgatcaaccacagaggagaagtcaaaataactgacttt
ggtgtgagtaccgttatgacaaacaccgcaggtttagcaaacacatttgtggggacttac
aattatatgtctccagagagaatcgttggaaacaagtacggaaataaaagtgatatatgg
agcttgggtttagtagtactcgaatgtgcaacaggaaagttcccttatgcacctccgaat
caagaggaaacatggaccagtgttttcgagttgatggaagccattgttgaccaaccgcca
cccgctcttccttcaggaaatttctcccctgagttatcttcattcatctccacatgtttg
cagaaggatccaaacagtcgaagctctgcaaaggaactgatggaacatcctttcttgaac
aaatacgactactcggggatcaatctcgcgtcctacttcacagatgcaggatcgccactt
gcaacacttgggaacctgtctggtacgttctccgtgtaa

DBGET integrated database retrieval system